KEGG   Homo sapiens (human): 112937
Entry
112937            CDS       T01001                                 

Gene name
GLB1L3
Definition
(RefSeq) galactosidase beta 1 like 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42
Other DBs
NCBI-GeneID: 112937
NCBI-ProteinID: NP_001073876
HGNC: 25147
Ensembl: ENSG00000166105
Vega: OTTHUMG00000133524
Pharos: Q8NCI6(Tdark)
UniProt: Q8NCI6
Position
11q25
AA seq 653 aa
MKSPPLLSPCLSWKRMAGIFFLPFISSGFAPRFKQEENFMLGRAHPSQPRFNWSHLTPLE
LKNRSVGLGTESTGRGKPHFTLEGHKFLIFGGSIHYFRVPREYWRDRLLKLKACGFNTVT
TYVPWNLHEPERGKFDFSGNLDLEAFVLMAAEIGLWVILRPGRYICSEMDLGGLPSWLLQ
DPRLLLRTTNKSFIEAVEKYFDHLIPRVIPLQYRQAGPVIAVQVENEYGSFNKDKTYMPY
LHKALLRRGIVELLLTSDGEKHVLSGHTKGVLAAINLQKLHQDTFNQLHKVQRDKPLLIM
EYWVGWFDRWGDKHHVKDAKEVEHAVSEFIKYEISFNVYMFHGGTNFGFMNGATYFGKHS
GIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKAVYPPVRPSLYLPL
WDALSYLNEPVRSRQPVNMENLPINNGSGQSYGLVLYEKSICSGGRLRAHAHDVAQVFLD
ETMIGILNENNKDLHIPELRDCRYLRILVENQGRVNFSWQIQNEQKGITGSVSINNSSLE
GFTIYSLEMKMSFFERLRSATWKPVPDSHQGPAFYCGTLKAGPSPKDTFLSLLNWNYGFV
FINGRNLGRYWNIGPQKTLYLPGVWLHPEDNEVILFEKMMSGSDIKSTDKPTL
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgaagtccccgcccctcctcagcccgtgtctctcctggaagagaatggcgggcatcttt
ttcctgccatttatctcatcaggttttgctcctcggtttaagcaggaagagaacttcatg
cttggaagagcgcatccgtcccagcctaggtttaattggtctcatctgacccctctggag
ctgaagaatcgatctgtgggacttggaactgaaagcacaggtcggggtaagccccacttc
acactggagggccacaagttcctgatcttcgggggctccatccactatttccgggtgccc
agggagtactggagggaccgcctgctgaagctgaaggcctgtggcttcaatactgtcacc
acctatgttccgtggaacctgcatgagccagaaagaggcaaatttgacttctctgggaac
ctggacctggaggccttcgtcctgatggccgcagagatcgggctgtgggtgattctgcgt
ccaggccgctacatctgcagtgagatggacctcgggggcttgcccagctggctcctgcaa
gacccccggttactgttgaggacaaccaacaagagcttcattgaagcagttgagaagtat
tttgaccacctgattcccagagtgattcctctccagtaccgccaggcaggccctgtcatc
gcggtgcaagtggagaatgagtatggctcattcaataaggataaaacatacatgccgtat
ctccacaaggccctgctgagaagagggattgtggagcttctcttgacctctgatggtgag
aaacatgtgctgagtggccacaccaaaggagtgttggccgccatcaatttgcaaaaactt
caccaggatactttcaatcagcttcataaagtccagagagataagccccttctgattatg
gaatactgggtcggctggttcgacagatggggagataagcaccatgttaaagatgcaaag
gaggttgaacatgctgtgtctgaattcatcaaatatgagatctccttcaatgtatatatg
ttccatggtggaaccaactttggtttcatgaacggggccacatatttcgggaagcactcg
ggcattgtcaccagctatgactatgatgcagtgctcacggaggctggagattacacagaa
aaatatctgaagcttcaaaaactctttcaatctgtctcagcaactcccctgccccgagta
cccaaacttcctcccaaggctgtgtatccccccgtgagaccgtcgctgtacctcccgctg
tgggacgccctatcctacttaaatgagccagtcaggtcgcgtcagcccgtcaacatggag
aaccttcccataaacaatgggagcggccagtcctacgggcttgtcctgtatgagaagtcc
atctgctccggaggccgcctccgtgcccacgctcatgacgtggcacaggtgtttttggat
gagacaatgatagggattctgaatgagaataataaggacctgcacattcctgaactcagg
gactgccgatacctgaggatcctggtggagaatcaaggacgagtcaatttttcatggcaa
atacagaatgagcagaaaggaataactggatctgtcagcatcaataactcttccctggag
ggctttaccatctattccctggagatgaaaatgagcttctttgagaggctccgctctgcc
acctggaagcctgtcccagacagccaccagggcccggccttctactgtgggaccttgaag
gctggcccttctcccaaggacaccttcctgagcctgctgaactggaattatggatttgtg
ttcatcaatggacgtaaccttgggcgatattggaatattgggcctcagaaaacactgtac
cttcctggagtttggcttcatccagaagacaatgaggtcatcttgtttgagaagatgatg
agtggctcagatatcaaatctacagacaagcccacgctgtaa

DBGET integrated database retrieval system