KEGG   Homo sapiens (human): 1130Help
Entry
1130              CDS       T01001                                 

Gene name
LYST, CHS, CHS1
Definition
(RefSeq) lysosomal trafficking regulator
  KO
K22937  lysosomal-trafficking regulator
Organism
hsa  Homo sapiens (human)
Disease
H00101  Other phagocyte defects
H02021  Chediak-Higashi syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1130 (LYST)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    1130 (LYST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beach PH_BEACH WD40 DUF4800
Motif
Other DBs
NCBI-GeneID: 1130
NCBI-ProteinID: NP_000072
OMIM: 606897
HGNC: 1968
Ensembl: ENSG00000143669
Vega: OTTHUMG00000040527
Pharos: Q99698(Tbio)
UniProt: Q99698
Position
1q42.3
AA seq 3801 aa AA seqDB search
MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEEKATDFNLPLSADIILTKEKNSSSQRSTQE
KLHLEGSALSSQVSAKVNVFRKSRRQRKITHRYSVRDARKTQLSTSDSEANSDEKGIAMN
KHRRPHLLHHFLTSFPKQDHPKAKLDRLATKEQTPPDAMALENSREIIPRQGSNTDILSE
PAALSVISNMNNSPFDLCHVLLSLLEKVCKFDVTLNHNSPLAASVVPTLTEFLAGFGDCC
SLSDNLESRVVSAGWTEEPVALIQRMLFRTVLHLLSVDVSTAEMMPENLRKNLTELLRAA
LKIRICLEKQPDPFAPRQKKTLQEVQEDFVFSKYRHRALLLPELLEGVLQILICCLQSAA
SNPFYFSQAMDLVQEFIQHHGFNLFETAVLQMEWLVLRDGVPPEASEHLKALINSVMKIM
STVKKVKSEQLHHSMCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSKNPFEETADGD
VYYPERCCCIAVCAHQCLRLLQQASLSSTCVQILSGVHNIGICCCMDPKSVIIPLLHAFK
LPALKNFQQHILNILNKLILDQLGGAEISPKIKKAACNICTVDSDQLAQLEETLQGNLCD
AELSSSLSSPSYRFQGILPSSGSEDLLWKWDALKAYQNFVFEEDRLHSIQIANHICNLIQ
KGNIVVQWKLYNYIFNPVLQRGVELAHHCQHLSVTSAQSHVCSHHNQCLPQDVLQIYVKT
LPILLKSRVIRDLFLSCNGVSQIIELNCLNGIRSHSLKAFETLIISLGEQQKDASVPDID
GIDIEQKELSSVHVGTSFHHQQAYSDSPQSLSKFYAGLKEAYPKRRKTVNQDVHINTINL
FLCVAFLCVSKEAESDRESANDSEDTSGYDSTASEPLSHMLPCISLESLVLPSPEHMHQA
ADIWSMCRWIYMLSSVFQKQFYRLGGFRVCHKLIFMIIQKLFRSHKEEQGKKEGDTSVNE
NQDLNRISQPKRTMKEDLLSLAIKSDPIPSELGSLKKSADSLGKLELQHISSINVEEVSA
TEAAPEEAKLFTSQESETSLQSIRLLEALLAICLHGARTSQQKMELELPNQNLSVESILF
EMRDHLSQSKVIETQLAKPLFDALLRVALGNYSADFEHNDAMTEKSHQSAEELSSQPGDF
SEEAEDSQCCSFKLLVEEEGYEADSESNPEDGETQDDGVDLKSETEGFSASSSPNDLLEN
LTQGEIIYPEICMLELNLLSASKAKLDVLAHVFESFLKIIRQKEKNVFLLMQQGTVKNLL
GGFLSILTQDDSDFQACQRVLVDLLVSLMSSRTCSEELTLLLRIFLEKSPCTKILLLGIL
KIIESDTTMSPSQYLTFPLLHAPNLSNGVSSQKYPGILNSKAMGLLRRARVSRSKKEADR
ESFPHRLLSSWHIAPVHLPLLGQNCWPHLSEGFSVSLWFNVECIHEAESTTEKGKKIKKR
NKSLILPDSSFDGTESDRPEGAEYINPGERLIEEGCIHIISLGSKALMIQVWADPHNATL
IFRVCMDSNDDMKAVLLAQVESQENIFLPSKWQHLVLTYLQQPQGKRRIHGKISIWVSGQ
RKPDVTLDFMLPRKTSLSSDSNKTFCMIGHCLSSQEEFLQLAGKWDLGNLLLFNGAKVGS
QEAFYLYACGPNHTSVMPCKYGKPVNDYSKYINKEILRCEQIRELFMTKKDVDIGLLIES
LSVVYTTYCPAQYTIYEPVIRLKGQMKTQLSQRPFSSKEVQSILLEPHHLKNLQPTEYKT
IQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIKYNQQRVHELENCNGLSM
IHQVLIKQKCIVGFYILKTLLEGCCGEDIIYMNENGEFKLDVDSNAIIQDVKLLEELLLD
WKIWSKAEQGVWETLLAALEVLIRADHHQQMFNIKQLLKAQVVHHFLLTCQVLQEYKEGQ
LTPMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHPPTNTYVCHNPTNFYFSLHI
DGKIFQEKVRSIMYLRHSSSGGRSLMSPGFMVISPSGFTASPYEGENSSNIIPQQMAAHM
LRSRSLPAFPTSSLLTQSQKLTGSLGCSIDRLQNIADTYVATQSKKQNSLGSSDTLKKGK
EDAFISSCESAKTVCEMEAVLSAQVSVSDVPKGVLGFPVVKADHKQLGAEPRSEDDSPGD
ESCPRRPDYLKGLASFQRSHSTIASLGLAFPSQNGSAAVGRWPSLVDRNTDDWENFAYSL
GYEPNYNRTASAHSVTEDCLVPICCGLYELLSGVLLILPDVLLEDVMDKLIQADTLLVLV
NHPSPAIQQGVIKLLDAYFARASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFIEMF
FGRHIGLDEEFDLEDVRNMGLFQKWSVIPILGLIETSLYDNILLHNALLLLLQILNSCSK
VADMLLDNGLLYVLCNTVAALNGLEKNIPMSEYKLLACDIQQLFIAVTIHACSSSGSQYF
RVIEDLIVMLGYLQNSKNKRTQNMAVALQLRVLQAAMEFIRTTANHDSENLTDSLQSPSA
PHHAVVQKRKSIAGPRKFPLAQTESLLMKMRSVANDELHVMMQRRMSQENPSQATETELA
QRLQRLTVLAVNRIIYQEFNSDIIDILRTPENVTQSKTSVFQTEISEENIHHEQSSVFNP
FQKEIFTYLVEGFKVSIGSSKASGSKQQWTKILWSCKETFRMQLGRLLVHILSPAHAAQE
RKQIFEIVHEPNHQEILRDCLSPSLQHGAKLVLYLSELIHNHQGELTEEELGTAELLMNA
LKLCGHKCIPPSASTKADLIKMIKEEQKKYETEEGVNKAAWQKTVNNNQQSLFQRLDSKS
KDISKIAADITQAVSLSQGNERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAVWYDP
IYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLRDRQKSEDVVKPPLSYLFEDKTHSS
FSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESSSLQGEL
EPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILTNNLP
NLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDL
NDLLIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNS
GTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYL
PEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDL
VFGYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFHMAHV
SRPGAKLNIEGELPAAVGLLVQFAFRETREQVKEITYPSPLSWIKGLKWGEYVGSPSAPV
PVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAILSWG
YADNILRLKSKQSEPPVNFIQSSQQYQVTSCAWVPDSCQLFTGSKCGVITAYTNRFTSST
PSEIEMETQIHLYGHTEEITSLFVCKPYSILISVSRDGTCIIWDLNRLCYVQSLAGHKSP
VTAVSASETSGDIATVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEGVSIN
VIAGGLENGIVRLWSTWDLKPVREITFPKSNKPIISLTFSCDGHHLYTANSDGTVIAWCR
KDQQRLKQPMFYSFLSSYAAG
NT seq 11406 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacagtaactcactggcacgtgaatttctgaccgatgtcaaccggctttgc
aatgcagtggtccagagggtggaggccagggaggaagaagaggaggagacgcacatggca
acccttggacagtaccttgtccatggtcgaggatttctattacttaccaagctaaattct
ataattgatcaggcattgacatgtagagaagaactcctgactcttcttctgtctctcctt
ccactggtatggaagatacctgtccaagaagaaaaggcaacagattttaacctaccgctc
tcagcagatataatcctgaccaaagaaaagaactcaagttcacaaagatccactcaggaa
aaattacatttagaaggaagtgccctgtctagtcaggtttctgcaaaagtaaatgttttt
cgaaaaagcagacgacagcgtaaaattacccatcgctattctgtaagagatgcaagaaag
acacagctctccacctcagattcagaagccaattcagatgaaaaaggcatagcaatgaat
aagcatagaaggccccatctgctgcatcattttttaacatcgtttcctaaacaagaccac
cccaaagctaaacttgaccgcttagcaaccaaagaacagactcctccagatgctatggct
ttggaaaattccagagagattattccaagacaggggtcaaacactgacattttaagtgag
ccagctgccttgtctgttatcagtaacatgaacaattctccatttgacttatgtcatgtt
ttgttatctttattagaaaaagtttgtaagtttgacgttaccttgaatcataattctcct
ttagcagccagtgtagtgcccacactaactgaattcctagcaggctttggggactgctgc
agtctgagcgacaacttggagagtcgagtagtttctgcaggttggaccgaagaaccggtg
gctttgattcaaaggatgctctttcgaacagtgttgcatcttctgtcagtagatgttagt
actgcagagatgatgccagaaaatcttaggaaaaatttaactgaattgcttagagcagct
ttaaaaattagaatatgcctagaaaagcagcctgacccttttgcaccaagacaaaagaaa
acactgcaggaggttcaggaagattttgtgttttcaaagtatcgtcatagagcccttctt
ttacctgagcttttggaaggagttcttcagattctgatctgttgtcttcaaagtgcagct
tcaaatcccttctacttcagtcaagccatggatttggttcaagaattcattcagcatcat
ggatttaatttatttgaaacagcagttcttcaaatggaatggctggttttaagagatgga
gttcctcccgaggcctcagagcatttgaaagccctaataaatagtgtgatgaaaataatg
agcactgtcaaaaaagtgaaatcagagcaacttcatcattcgatgtgtacaagaaaaagg
cacagacgatgtgaatattctcattttatgcatcatcaccgagatctctcaggtcttctg
gtttcggcttttaaaaaccaggtttccaaaaacccatttgaagagactgcagatggagat
gtttattatcctgagcggtgctgttgcattgcagtgtgtgcccatcagtgcttgcgctta
ctacagcaggcttccttgagcagcacttgtgtccagatcctatcgggtgttcataacatt
ggaatatgctgttgtatggatcccaaatctgtaatcattcctttgctccatgcttttaaa
ttgccagcactgaaaaattttcagcagcatatattgaatatccttaacaaacttattttg
gatcagttaggaggagcagagatatcaccaaaaattaaaaaagcagcttgtaatatttgt
actgttgactctgaccaactagcccaattagaagagacactgcagggaaacttatgtgat
gctgaactctcctcaagtttatccagtccttcttacagatttcaagggatcctgcccagc
agtggatctgaagatttgttgtggaaatgggatgctttaaaggcttatcagaactttgtt
tttgaagaagacagattacatagtatacagattgcaaatcacatttgcaatttaatccag
aaaggcaatatagttgttcagtggaaattatataattacatatttaatcctgtgctccaa
agaggagttgaattagcacatcattgtcaacacctaagcgttacttcagctcaaagtcat
gtatgtagccatcataaccagtgcttgcctcaggacgtgcttcagatttatgtaaaaact
ctgcctatcctgcttaaatccagggtaataagagatttgtttttgagttgtaatggagta
agtcaaataatcgaattaaattgcttaaatggtattcgaagtcattctctaaaagcattt
gaaactctgataatcagcctaggggagcaacagaaagatgcctcagttccagatattgat
gggatagacattgaacagaaggagttgtcctctgtacatgtgggtacttcttttcatcat
cagcaagcttattcagattctcctcagagtctcagcaaattttatgctggcctcaaagaa
gcttatccaaagagacggaagactgttaaccaagatgttcatatcaacacaataaaccta
ttcctctgtgtggcttttttatgcgtaagtaaagaagcagagtctgacagggagtcggcc
aatgactcagaagatacttctggctatgacagcacagccagcgagcctttaagtcatatg
ctgccatgtatatctctcgagagccttgtcttgccttctcctgaacatatgcaccaagca
gcagacatttggtctatgtgtcgttggatctacatgttgagttcagtgttccagaaacag
ttttataggcttggtggtttccgagtatgccataagttaatatttatgataatacagaaa
ctgttcagaagtcacaaagaggagcaaggaaaaaaggagggagatacaagtgtaaatgaa
aaccaggatttaaacagaatttctcaacctaagagaactatgaaggaagatttattatct
ttggctataaaaagtgaccccataccatcagaactaggtagtctaaaaaagagtgctgac
agtttaggtaaattagagttacagcatatttcttccataaatgtggaagaagtttcagct
actgaagccgctcccgaggaagcaaagctatttacaagtcaagaaagtgagacctcactt
caaagtatacgacttttggaagcccttctggccatttgtcttcatggtgccagaactagt
caacagaagatggaattggagttacctaatcagaacttgtctgtggaaagtatattattt
gaaatgagggaccatctttcccagtcaaaggtgattgaaacacaactagcaaagccttta
tttgatgccctgcttcgagttgccctcgggaattattcagcagattttgaacataatgat
gctatgactgagaagagtcatcaatctgcagaagaattgtcatcccagcctggtgatttt
tcagaagaagctgaggattctcagtgttgtagttttaaacttttagttgaagaagaaggt
tacgaagcagatagtgaaagcaatcctgaagatggcgaaacccaggatgatggggtagac
ttaaagtctgaaacagaaggtttcagtgcatcaagcagtccaaatgacttactcgaaaac
ctcactcaaggggaaataatttatcctgagatttgtatgctggaattaaatttgctttct
gctagtaaagccaaacttgatgtgcttgcccatgtatttgagagttttttgaaaattatt
aggcagaaagaaaagaatgtttttctgctcatgcaacagggaactgtgaaaaatctttta
ggagggttcttgagtattttaacacaggatgattctgattttcaagcatgccagagagta
ttggtggatcttttggtatctttgatgagttcaagaacatgttcagaagagctaaccctt
cttttgagaatatttctggagaaatctccttgtacaaaaattcttcttctgggtattctg
aaaattattgaaagtgatactactatgagcccttcacagtatctaaccttccctttactg
cacgctccaaatttaagcaacggtgtttcatcacaaaagtatcctgggattttaaacagt
aaggccatgggtttattgagaagagcacgagtttcacggagcaagaaagaggctgataga
gagagttttccccatcggctgctttcatcttggcacatagccccagtccacctgccgttg
ctggggcaaaactgctggccacacctatcagaaggtttcagtgtttccctgtggtttaat
gtggagtgtatccatgaagctgagagtactacagaaaaaggaaagaagataaagaaaaga
aacaaatcattaattttaccagatagcagttttgatggtacagagagcgacagaccagaa
ggtgcagagtacataaatcctggtgaaagactcatagaagaaggatgtattcatataatt
tcactgggatccaaagcgttgatgatccaagtgtgggctgatccccacaatgccactctt
atctttcgtgtgtgcatggattcaaatgatgacatgaaagctgttttactagcacaggtt
gaatcacaggagaatattttcctcccaagcaaatggcaacatttagtactcacctactta
cagcagccccaagggaaaaggaggattcatgggaaaatctccatatgggtctctggacag
aggaagcctgatgttactttggattttatgcttccaagaaaaacaagtttgtcatctgat
agcaataaaacattttgcatgattggccattgtttatcatcccaagaagagtttttgcag
ttggctggaaaatgggacctgggaaatttgcttctcttcaacggagctaaggttggttca
caagaggccttttatctgtatgcttgtggacccaaccatacatctgtaatgccatgtaag
tatggcaagccagtcaatgactactccaaatatattaataaagaaattttgcgatgtgaa
caaatcagagaactttttatgaccaagaaagatgtggatattggtctcttaattgaaagt
ctttcagttgtttatacaacttactgtcctgctcagtataccatctatgaaccagtgatt
agacttaaaggtcaaatgaaaacccaactctctcaaagacccttcagctcaaaagaagtt
cagagcatcttattagaacctcatcatctaaagaatctccaacctactgaatataaaact
attcaaggcattctgcacgaaattggtggaactggcatatttgtttttctctttgccagg
gttgttgaactcagtagctgtgaagaaactcaagcattagcactgcgagttatactctca
ttaattaaatacaaccaacaaagagtacatgaattagaaaattgtaatggactttctatg
attcatcaggtgttgatcaaacaaaaatgcattgttgggttttacattttgaagaccctt
cttgaaggatgctgtggtgaagatattatttatatgaatgagaatggagagtttaagttg
gatgtagactctaatgctataatccaagatgttaagctgttagaggaactattgcttgac
tggaagatatggagtaaagcagagcaaggtgtttgggaaactttgctagcagctctagaa
gtcctcatcagagcagatcaccaccagcagatgtttaatattaagcagttattgaaagct
caagtggttcatcactttctactgacttgtcaggttttgcaggaatacaaagaggggcaa
ctcacacccatgccccgagaggtttgtagatcatttgtgaaaattatagcagaagtcctt
ggatctcctccagatttggaattattgacaattatcttcaatttccttttagcagttcac
cctcctactaatacttacgtttgtcacaatcccacgaacttctacttttctttgcacata
gatggcaagatctttcaggagaaagtgcggtcaatcatgtacctgaggcattccagcagt
ggaggaaggtcccttatgagccctggatttatggtaataagcccatctggttttactgct
tcaccatatgaaggagagaattcctctaatattattccacaacagatggccgcccatatg
ctgcgttctagaagcctaccagcattccctacttcttcactactaacgcaatcacaaaaa
ctgactggaagtttgggttgtagtatcgacaggttacaaaatattgcagatacttatgtt
gccacccaatcaaagaaacaaaattctttggggagttccgacacactgaaaaaaggcaaa
gaggacgcattcatcagtagctgtgagtctgcaaaaactgtttgtgaaatggaagctgtc
ctctcagcccaggtctctgtcagtgatgtcccaaagggagtgctgggatttccagtggtc
aaagcagatcataaacagttgggagcagaacccaggtcagaagatgacagtcctggggat
gagtcctgcccacgccgacctgattacctaaagggattggcctccttccagcgaagccac
agcactattgcaagccttgggctagcttttccttcacagaacggatctgcagctgttggc
cgttggccaagtcttgttgatagaaacactgatgattgggaaaactttgcctattctctt
ggttatgagccaaattacaaccgaactgcaagtgctcacagtgtaactgaagactgtttg
gtacctatatgctgtggattatatgaactcctaagtggggttcttcttatcctgcctgat
gttttgcttgaagatgtgatggacaagcttattcaagcagatacacttttggtcctcgtt
aaccacccatcaccagctatacaacaaggtgttattaaactattagatgcatattttgct
agagcatctaaggaacaaaaagataaatttctgaagaatcgtggattttccttgctagcc
aaccagttgtatcttcatcgaggaactcaagaattgttagaatgcttcatcgaaatgttc
tttggtcgacatattggccttgatgaagaatttgatctggaagatgtgagaaacatggga
ttgtttcagaagtggtctgtcattcctattctgggactaatagagacctctctatatgac
aacatactcttgcataatgctcttttacttcttctccaaattttaaattcttgttctaag
gtagcagatatgttgctggataatggtctactctatgtgttatgtaatacagtagcagcc
ctgaatggattagaaaagaacattcccatgagtgaatataaattgcttgcttgtgatata
cagcaacttttcatagcagttacaattcatgcttgcagttcctcaggctcacaatatttt
agggttattgaagaccttattgtaatgcttggatatcttcaaaatagcaaaaacaagagg
acacaaaatatggctgttgcactacagcttagagttctccaggctgctatggaatttata
aggaccaccgcaaatcatgactctgaaaacctcacagattcactccagtcaccttctgct
ccccatcatgcagtagttcaaaagcggaaaagcattgctggtcctcgaaaatttcccctt
gctcaaactgaatcgcttctgatgaaaatgcgttcagtggcaaatgatgagcttcatgtg
atgatgcaacggagaatgagccaagagaaccctagccaagcaactgaaacggaacttgcg
cagagactacagaggctcactgttttagcagtcaacaggattatttatcaagaatttaat
tcagacattattgacattttgagaactccagaaaatgtaactcaaagcaagacctcagtt
ttccagaccgaaatttctgaggaaaatattcatcatgaacagtcttctgttttcaatcca
tttcagaaagaaatttttacatatctggtagaaggattcaaagtatctattggttcaagt
aaagccagtggttccaagcagcaatggactaaaattctgtggtcttgtaaggagaccttc
cgaatgcagcttgggagactactagtgcatattttgtcgccagcccacgctgcacaagag
agaaagcaaatttttgaaatagttcatgaaccaaatcatcaggaaatactacgagactgt
ctcagcccatccctacaacatggagccaagttagttttgtatttgtcagagttgatacat
aatcaccaaggtgaattgactgaagaagagctaggcacagcagaactgcttatgaatgct
ttgaagttatgtggtcacaagtgcatccctcccagtgcatcaacaaaagcagaccttatt
aaaatgatcaaagaggaacaaaagaaatatgaaactgaagaaggagtgaataaagctgct
tggcagaaaacagttaacaataatcaacaaagtctctttcagcgtctggattcaaaatca
aaggatatatctaaaatagctgcagatatcacccaggcagtgtctctctcccaaggaaat
gagagaaaaaaggtgatccagcatattagaggaatgtataaagtagatttgagtgccagc
agacattggcaggaacttattcagcagctgacacatgatagagcagtatggtatgacccc
atctactatccaacctcatggcagttggatccaacagaagggccaaatcgagagaggaga
cgtttacagagatgttatttaactattccaaataagtatctccttagggatagacagaaa
tcagaagatgttgtcaaaccaccactctcttacctgtttgaagacaaaactcattcttct
ttctcttctactgtcaaagacaaagctgcaagtgaatctataagagtgaatcgaagatgc
atcagtgttgcaccatctagagagacagctggtgaattgttactaggtaaatgtggaatg
tattttgtggaagataatgcttctgatacagttgaaagttcgagccttcagggagagttg
gaaccagcatcattttcctggacatatgaagaaattaaagaagttcacaagcgttggtgg
caattgagagataatgctgtagaaatctttctaacaaatggcagaacactcctgttggca
tttgataacaccaaggttcgtgatgatgtataccacaatatactcacaaataacctccct
aatcttctggaatatggtaacatcaccgctctgacaaatttatggtatactgggcaaatt
actaattttgaatatttgactcacttaaacaaacatgctggccgatccttcaatgatctc
atgcagtatcctgtgttcccatttatacttgctgactacgttagtgagacacttgacctc
aatgatctgttgatatacagaaatctctctaaacctatagctgttcagtataaagaaaaa
gaagatcgttatgtggacacatacaagtacttggaggaagagtaccgcaaaggagccaga
gaagatgaccccatgcctcccgtgcagccctatcactatggctcccactattccaatagc
ggcactgtgcttcacttcctggtcaggatgcctcctttcactaaaatgtttttagcctat
caagatcaaagttttgacattccagacagaacttttcattctacaaatacaacttggcga
ctctcatcttttgaatctatgactgatgtgaaagaacttatcccagagtttttctatctt
ccagagttcctagttaaccgtgaaggttttgattttggtgtgcgtcagaatggtgaacgg
gttaatcacgtcaaccttcccccttgggcgcgtaatgatcctcgtctttttatcctcatc
catcggcaggctctagagtctgactacgtgtcgcagaacatctgtcagtggattgacttg
gtgtttgggtataagcaaaaggggaaggcttctgttcaagcgatcaatgtttttcatcct
gctacatattttggaatggatgtctctgcagttgaagatccagttcagagacgagcgcta
gaaaccatgataaaaacctacgggcagactccccgtcagctgttccacatggcccatgtg
agcagacctggagccaagctcaatattgaaggagagcttccagctgctgtggggttgcta
gtgcagtttgctttcagggagacccgagaacaggtcaaagaaatcacctatccgagtcct
ttgtcatggataaaaggcttgaaatggggggaatacgtgggttcccccagtgctccagta
cctgtggtctgcttcagccagccccacggagaaagatttggctctctccaggctctgccc
accagagcaatctgtggtttgtcacggaatttctgtcttctgatgacatatagcaaggaa
caaggtgtgagaagcatgaacagtacggacattcagtggtcagccatcctgagctgggga
tatgctgataatattttaaggttgaagagtaaacaaagtgagcctccagtaaactttatt
caaagttcacaacagtaccaggtgactagttgtgcttgggtgcctgacagttgccagctg
tttactggaagcaaatgcggtgtcatcacagcctacacaaacagatttacaagcagcacg
ccatcagaaatagaaatggagactcaaatacatctctatggtcacacagaagagataacc
agcttatttgtttgcaaaccatacagtatactgataagtgtgagcagagacggaacctgc
atcatatgggatttaaacaggttatgctatgtacaaagtctggcgggacacaaaagccct
gtcacagctgtctctgccagtgaaacctcaggtgatattgctactgtgtgtgattcagct
ggcggaggcagtgacctcagactctggacggtgaacggggatctcgttggacatgtccac
tgcagggagatcatctgttccgtggctttctccaaccagcctgagggagtatctatcaat
gtaatcgctgggggattagaaaatggaattgtaaggttatggagcacatgggacttaaag
cctgtgagagaaattacatttcccaaatcaaataagcccatcatcagccttacattttct
tgtgatggccaccatttgtacacagcaaacagtgatgggaccgtgattgcctggtgtcgg
aaggaccagcagcgcttgaaacagccaatgttctattccttccttagcagctatgcagcc
gggtga

DBGET integrated database retrieval system