KEGG   Homo sapiens (human): 113026
Entry
113026            CDS       T01001                                 
Symbol
PLCD3, PLC-delta-3
Name
(RefSeq) phospholipase C delta 3
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113026 (PLCD3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113026 (PLCD3)
   04070 Phosphatidylinositol signaling system
    113026 (PLCD3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113026 (PLCD3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    113026 (PLCD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113026 (PLCD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    113026 (PLCD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     113026 (PLCD3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    113026 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    113026 (PLCD3)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 EF-hand_7 S_100 PH SPARC_Ca_bdg FANC_SAP CTD1
Other DBs
NCBI-GeneID: 113026
NCBI-ProteinID: NP_588614
OMIM: 608795
HGNC: 9061
Ensembl: ENSG00000161714
Pharos: Q8N3E9(Tbio)
UniProt: Q8N3E9
Position
17:complement(45108959..45132515)
AA seq 789 aa
MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDE
DVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREG
HQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQR
ERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEG
AEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYE
LNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTYLTDSQ
IGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVK
GKKLPAARSEDGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRL
RTLHPAPNAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQ
EMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYPGPPRT
TLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCARQETDYVLNNGFNPRWGQTL
QFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATL
FIQIRIQRS
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgctgtgcggccgctggaggcgttgccgccgcccgcccgaggagcccccggtggccgcc
caggtcgcagcccaagtcgcggcgccggtcgctctcccgtccccgccgactccctccgat
ggcggcaccaagaggcccgggctgcgggcgctgaagaagatgggcctgacggaggacgag
gacgtgcgcgccatgctgcggggctcccggctccgcaagatccgctcgcgcacgtggcac
aaggagcggctgtaccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatc
ccgcgtgcgccatcgcagcacatcttcttcgtgcagcacatcgaggcggtccgcgagggc
caccagtccgagggcctgcggcgcttcgggggtgccttcgcgccagcgcgctgcctcacc
atcgccttcaagggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcg
cagcgctgggtgcgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgc
gagcggctagaccactggatccactcctatctgcaccgggctgactccaaccaggacagc
aagatgagcttcaaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgac
atgtacgcctacctcctcttcaaggagtgtgaccactccaacaacgaccgtctagagggg
gctgagatcgaggagttcctgcggcggctgctgaagcggccggagctggaggagatcttc
catcagtactcgggcgaggaccgcgtgctgagtgcccctgagctgctggagttcctggag
gaccagggcgaggagggcgccacactggcccgcgcccagcagctcattcagacctatgag
ctcaacgagacagccaagcagcatgagctgatgacactggatggcttcatgatgtacctg
ttgtcgccggagggggctgccttggacaacacccacacgtgtgtgttccaggacatgaac
cagccccttgcccactacttcatctcttcctcccacaacacctatctgactgactcccag
atcggggggcccagcagcaccgaggcctatgttagggcctttgcccagggatgccgctgc
gtggagctggactgctgggaggggccaggaggggagcccgtcatctatcatggccatacc
ctcacctccaagattctcttccgggacgtggtccaagccgtgcgcgaccatgccttcacg
ctgtccccttaccctgtcatcctatccctggagaaccactgcgggctggagcagcaggct
gccatggcccgccacctctgcaccatcctgggggacatgctggtgacacaggcgctggac
tccccaaatcccgaggagctgccatccccagagcagctgaagggccgggtcctggtgaag
ggaaagaagttgcccgctgctcggagcgaggatggccgggctctgtcggatcgggaggag
gaggaggaggatgacgaggaggaagaagaggaggtggaggctgcagcgcagaggcggctg
gccaagcagatctccccggagctgtcggccctggctgtgtactgccacgccacccgcctg
cggaccctgcaccctgcccccaacgccccacaaccctgccaggtcagctccctcagcgag
cgcaaagccaagaaactcattcgggaggcagggaacagctttgtcaggcacaatgcccgc
cagctgacccgcgtgtacccgctggggctgcggatgaactcagccaactacagtccccag
gagatgtggaactcgggctgtcagctggtggccttgaacttccagacgccaggctacgag
atggacctcaatgccgggcgcttcctagtcaatgggcagtgtggctacgtcctaaaacct
gcctgcctgcggcaacctgactcgacctttgaccccgagtacccaggacctcccagaacc
actctcagcatccaggtgctgactgcacagcagctgcccaagctgaatgccgagaagcca
cactccattgtggaccccctggtgcgcattgagatccatggggtgcccgcagactgtgcc
cggcaggagactgactacgtgctcaacaatggcttcaacccccgctgggggcagaccctg
cagttccagctgcgggctccggagctggcactggtccggtttgtggtggaagattatgac
gccacctcccccaatgactttgtgggccagtttacactgcctcttagcagcctaaagcaa
gggtaccgccacatacacctgctttccaaggacggggcctcactgtcaccagccacgctc
ttcatccaaatccgcatccagcgctcctga

DBGET integrated database retrieval system