KEGG   Homo sapiens (human): 113026Help
Entry
113026            CDS       T01001                                 

Gene name
PLCD3, PLC-delta-3
Definition
(RefSeq) phospholipase C delta 3
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113026 (PLCD3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113026 (PLCD3)
   04070 Phosphatidylinositol signaling system
    113026 (PLCD3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113026 (PLCD3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113026 (PLCD3)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    113026 (PLCD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    113026 (PLCD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     113026 (PLCD3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    113026 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    113026 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 S_100 PH EF-hand_7 SPARC_Ca_bdg TEP1_N
Motif
Other DBs
NCBI-GeneID: 113026
NCBI-ProteinID: NP_588614
OMIM: 608795
HGNC: 9061
Ensembl: ENSG00000161714
Vega: OTTHUMG00000168029
Pharos: Q8N3E9(Tbio)
UniProt: Q8N3E9
Position
17q21.31
AA seq 789 aa AA seqDB search
MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDE
DVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREG
HQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQR
ERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEG
AEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYE
LNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTYLTDSQ
IGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVK
GKKLPAARSEDGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRL
RTLHPAPNAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQ
EMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYPGPPRT
TLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCARQETDYVLNNGFNPRWGQTL
QFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATL
FIQIRIQRS
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggccgctggaggcgttgccgccgcccgcccgaggagcccccggtggccgcc
caggtcgcagcccaagtcgcggcgccggtcgctctcccgtccccgccgactccctccgat
ggcggcaccaagaggcccgggctgcgggcgctgaagaagatgggcctgacggaggacgag
gacgtgcgcgccatgctgcggggctcccggctccgcaagatccgctcgcgcacgtggcac
aaggagcggctgtaccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatc
ccgcgtgcgccatcgcagcacatcttcttcgtgcagcacatcgaggcggtccgcgagggc
caccagtccgagggcctgcggcgcttcgggggtgccttcgcgccagcgcgctgcctcacc
atcgccttcaagggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcg
cagcgctgggtgcgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgc
gagcggctagaccactggatccactcctatctgcaccgggctgactccaaccaggacagc
aagatgagcttcaaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgac
atgtacgcctacctcctcttcaaggagtgtgaccactccaacaacgaccgtctagagggg
gctgagatcgaggagttcctgcggcggctgctgaagcggccggagctggaggagatcttc
catcagtactcgggcgaggaccgcgtgctgagtgcccctgagctgctggagttcctggag
gaccagggcgaggagggcgccacactggcccgcgcccagcagctcattcagacctatgag
ctcaacgagacagccaagcagcatgagctgatgacactggatggcttcatgatgtacctg
ttgtcgccggagggggctgccttggacaacacccacacgtgtgtgttccaggacatgaac
cagccccttgcccactacttcatctcttcctcccacaacacctatctgactgactcccag
atcggggggcccagcagcaccgaggcctatgttagggcctttgcccagggatgccgctgc
gtggagctggactgctgggaggggccaggaggggagcccgtcatctatcatggccatacc
ctcacctccaagattctcttccgggacgtggtccaagccgtgcgcgaccatgccttcacg
ctgtccccttaccctgtcatcctatccctggagaaccactgcgggctggagcagcaggct
gccatggcccgccacctctgcaccatcctgggggacatgctggtgacacaggcgctggac
tccccaaatcccgaggagctgccatccccagagcagctgaagggccgggtcctggtgaag
ggaaagaagttgcccgctgctcggagcgaggatggccgggctctgtcggatcgggaggag
gaggaggaggatgacgaggaggaagaagaggaggtggaggctgcagcgcagaggcggctg
gccaagcagatctccccggagctgtcggccctggctgtgtactgccacgccacccgcctg
cggaccctgcaccctgcccccaacgccccacaaccctgccaggtcagctccctcagcgag
cgcaaagccaagaaactcattcgggaggcagggaacagctttgtcaggcacaatgcccgc
cagctgacccgcgtgtacccgctggggctgcggatgaactcagccaactacagtccccag
gagatgtggaactcgggctgtcagctggtggccttgaacttccagacgccaggctacgag
atggacctcaatgccgggcgcttcctagtcaatgggcagtgtggctacgtcctaaaacct
gcctgcctgcggcaacctgactcgacctttgaccccgagtacccaggacctcccagaacc
actctcagcatccaggtgctgactgcacagcagctgcccaagctgaatgccgagaagcca
cactccattgtggaccccctggtgcgcattgagatccatggggtgcccgcagactgtgcc
cggcaggagactgactacgtgctcaacaatggcttcaacccccgctgggggcagaccctg
cagttccagctgcgggctccggagctggcactggtccggtttgtggtggaagattatgac
gccacctcccccaatgactttgtgggccagtttacactgcctcttagcagcctaaagcaa
gggtaccgccacatacacctgctttccaaggacggggcctcactgtcaccagccacgctc
ttcatccaaatccgcatccagcgctcctga

KEGG   Homo sapiens (human): 5333Help
Entry
5333              CDS       T01001                                 

Gene name
PLCD1, NDNC3, PLC-III
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H01307  Nonsyndromic congenital nail disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5333 (PLCD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5333 (PLCD1)
   04070 Phosphatidylinositol signaling system
    5333 (PLCD1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5333 (PLCD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5333 (PLCD1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5333 (PLCD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5333 (PLCD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5333 (PLCD1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5333 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5333 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 TEP1_N
Motif
Other DBs
NCBI-GeneID: 5333
NCBI-ProteinID: NP_006216
OMIM: 602142
HGNC: 9060
Ensembl: ENSG00000187091
Vega: OTTHUMG00000130813
Pharos: P51178(Tchem)
UniProt: P51178 A0A384MR47 A8K8F9
Position
3p22.2
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHK
PKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALIRFLVEDYDASSKNDFIGQST
IPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgatgaggatctacag
gcgctgctgaagggcagccagctcctgaaggtgaagtccagctcatggaggagagagcgc
ttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatggggcaccgc
acggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttctccattgtc
ttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgatgcccagcac
tgggtgctggggctgcacaagatcatccaccactcaggctccatggaccagcgtcagaag
ctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagctat
gcccggaagatcttcagggagtgtgaccactcccagacagactccctggaggacgaggag
attgaggccttctacaagatgctgacccagcgggtggagatcgaccgcaccttcgccgag
gccgcgggctcaggggagactctgtcggtggatcagttagtgacgttcctgcagcaccag
cagcgggaggaggcggcagggcctgcgctggccctctccctcattgagcgctacgagccc
agcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacttactg
tcggctgacggcagcgccttcagcctggcacaccgccgtgtctaccaggacatgggccag
ccacttagccactacctggtgtcctcttcacacaacacctacctgctggaggaccagcta
gccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgccgatgcctg
gagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggctatactttc
acttccaagatcctcttctgcgatgtgctcagggccatccgggactatgccttcaaggcg
tccccctaccctgtcatcctatccctggagaaccactgcacactggagcagcagcgcgtg
atggcgcggcacctgcatgccatcctgggccccatgctgttgaaccgaccactggatggg
gtcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctgaaggggaag
aagctcggggggctcctgccccctggaggggagggtggccctgaggccactgtggtgtca
gacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtgcagcacaag
cccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatttactgcaag
agtgtccactttgggggcttctccagtcctggcacccctggacaggccttctacgagatg
gcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaacggctttgtc
cgccacaacgtggggcacctgagcagaatctacccggctggatggagaacagactcctcc
aactacagccccgtggagatgtggaatgggggctgccagatcgtggccctgaatttccag
acacctgggccagagatggacgtgtaccagggccgcttccaggacaacggggcctgtggg
tacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccccgcgccctg
gctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcggggcagcag
ctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgacagtggagatc
catggcgtgagccgggacgtggccagccgccagactgctgtcatcaccaacaatggtttc
aacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgaccttgccctcatc
cgcttcttggtggaagattatgatgcctcctccaagaatgacttcattggccagagtacc
atccccttgaacagcctcaagcaaggataccgccatgtccacctcatgtctaagaacggg
gaccagcatccatcagccaccctctttgtgaagatctccctccaggactag

KEGG   Homo sapiens (human): 84812Help
Entry
84812             CDS       T01001                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C delta 4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    84812 (PLCD4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    84812 (PLCD4)
   04070 Phosphatidylinositol signaling system
    84812 (PLCD4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84812 (PLCD4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    84812 (PLCD4)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    84812 (PLCD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84812 (PLCD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     84812 (PLCD4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    84812 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    84812 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 PH GDPD PH_12 EF-hand_8 Wap1 SBP_bac_5
Motif
Other DBs
NCBI-GeneID: 84812
NCBI-ProteinID: NP_116115
OMIM: 605939
HGNC: 9062
Ensembl: ENSG00000115556
Vega: OTTHUMG00000154743
Pharos: Q9BRC7(Tbio)
UniProt: Q9BRC7
Position
2q35
AA seq 762 aa AA seqDB search
MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFV
QHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG
YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIF
GVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTL
PWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctgctgcaagaccagctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcgcaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggagacaatacgtaatggccatgattccgagttgctgcgtagc
ctggcagaggagctccccctggagcagggcttcaccattgtcttccatggccgccgctcc
aacctggacctgatggccaacagtgttgaggaggcccagatatggatgcgagggctccag
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagc
gattggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggaaatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctggaaccctggaaggagaagaattcgtacagttctataag
gcattgactaaacgtgctgaggtgcaggaactgtttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccaagaggagcagaaggagagagactgc
acctctgagcttgctctggaactcattgaccgctatgaaccttcagacagtggcaaactg
cggcatgtgctgagtatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcttctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagcggggaacctgtcgtttaccacggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacatcagactacccagtcatc
ttgtccctggagacccactgcagctgggagcagcagcagaccatggcccgtcatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcgcctgaggagcttcggaggaagatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagcagaacctgagttggaagagtcagaattggcg
ctggagtcccagtttgagactgagcctgagccccaggagcagaaccttcagaataaggac
aaaaagaagaaatccaagcccatcttgtgtccagccctctcttccctggttatctacttg
aagtctgtctcattccgcagcttcacacattcaaaggagcactaccacttctacgagata
tcatctttctctgaaaccaaggccaagcgcctcatcaaggaggctggcaatgagtttgtg
cagcacaatacttggcagttaagccgtgtgtatcccagcggcctgaggacagactcttcc
aactacaacccccaggaactctggaatgcaggctgccagatggtggccatgaatatgcag
actgcagggcttgaaatggacatctgtgatgggcatttccgccagaatggcggctgtggc
tatgtgctgaagccagacttcctgcgtgatatccagagttctttccaccctgagaagccc
atcagccctttcaaagcccagactctcttaatccaggtgatcagcggtcagcaactcccc
aaagtggacaagaccaaagaggggtccattgtggatccactggtgaaagtgcagatcttt
ggcgttcgtctagacacagcacggcaggagaccaactatgtggagaacaatggttttaat
ccatactgggggcagacactatgtttccgggtgctggtgcctgaacttgccatgctgcgt
tttgtggtaatggattatgactggaaatcccgaaatgactttattggtcagtacaccctg
ccttggacctgcatgcaacaaggttaccgccacattcacctgctgtccaaagatggcatc
agcctccgcccagcttccatctttgtgtatatctgcatccaggaaggcctggagggggat
gagtcctga

DBGET integrated database retrieval system