KEGG   Homo sapiens (human): 11309Help
Entry
11309             CDS       T01001                                 

Gene name
SLCO2B1, OATP-B, OATP2B1, OATPB, SLC21A9
Definition
(RefSeq) solute carrier organic anion transporter family member 2B1
  KO
K14352  solute carrier organic anion transporter family, member 2B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    11309 (SLCO2B1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   11309 (SLCO2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OATP MFS_1 Kazal_2
Motif
Other DBs
NCBI-GeneID: 11309
NCBI-ProteinID: NP_009187
OMIM: 604988
HGNC: 10962
Ensembl: ENSG00000137491
Vega: OTTHUMG00000165420
Pharos: O94956(Tbio)
UniProt: O94956 A0A024R5I4
Position
11q13.4
AA seq 709 aa AA seqDB search
MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgggacccaggatagggccagcgggtgaggtaccccaggtaccagacaaggaaaccaaa
gccacaatgggcacagaaaacacacctggaggcaaagccagcccagaccctcaggacgtg
cggccaagtgtgttccataacatcaagctgttcgttctgtgccacagcctgctgcagctg
gcgcagctcatgatctccggctacctaaagagctccatctccacagtggagaagcgcttc
ggcctctccagccagacgtcggggctgctggcctccttcaacgaggtggggaacacagcc
ttgattgtgtttgtgagctattttggcagccgggtgcaccgaccccgaatgattggctat
ggggctatccttgtggccctggcgggcctgctcatgactctcccgcacttcatctcggag
ccataccgctacgacaacaccagccctgaggatatgccacaggacttcaaggcttccctg
tgcctgcccacaacctcggccccagcctcggccccctccaatggcaactgctcaagctac
acagaaacccagcatctgagtgtggtggggatcatgttcgtggcacagaccctgctgggc
gtgggcggggtgcccattcagccctttggcatctcctacatcgatgactttgcccacaac
agcaactcgcccctctacctcgggatcctgtttgcagtgaccatgatggggccaggcctg
gcctttgggctgggcagcctcatgctgcgcctttatgtggacattaaccagatgccagaa
ggtggtatcagcctgaccataaaggacccccgatgggtgggtgcctggtggctgggtttc
ctcatcgctgccggtgcagtggccctggctgccatcccctacttcttcttccccaaggaa
atgcccaaggaaaaacgtgagcttcagtttcggcgaaaggtcttagcagtcacagactca
cctgccaggaagggcaaggactctccctctaagcagagccctggggagtccacgaagaag
caggatggcctagtccagattgcaccaaacctgactgtgatccagttcattaaagtcttc
cccagggtgctgctgcagaccctacgccaccccatcttcctgctggtggtcctgtcccag
gtatgcttgtcatccatggctgcgggcatggccaccttcctgcccaagttcctggagcgc
cagttttccatcacagcctcctacgccaacctgctcatcggctgcctctccttcccttcg
gtcatcgtgggcatcgtggtgggtggcgtcctggtcaagcggctccacctgggccctgtg
ggatgcggtgccctttgcctgctggggatgctgctgtgcctcttcttcagcctgccgctc
ttctttatcggctgctccagccaccagattgcgggcatcacacaccagaccagtgcccac
cctgggctggagctgtctccaagctgcatggaggcctgctcctgcccattggacggcttt
aaccctgtctgcgaccccagcactcgtgtggaatacatcacaccctgccacgcaggctgc
tcaagctgggtggtccaggatgctctggacaacagccaggttttctacaccaactgcagc
tgcgtggtggagggcaaccccgtgctggcaggatcctgcgactcaacgtgcagccatctg
gtggtgcccttcctgctcctggtcagcctgggctcggccctggcctgtctcacccacaca
ccctccttcatgctcatcctaagaggagtgaagaaagaagacaagactttggctgtgggc
atccagttcatgttcctgaggattttggcctggatgcccagccccgtgatccacggcagc
gccatcgacaccacctgtgtgcactgggccctgagctgtgggcgtcgagctgtctgtcgc
tactacaataatgacctgctccgaaaccggttcatcggcctccagttcttcttcaaaaca
ggttctgtgatctgcttcgccttagttttggctgtcctgaggcagcaggacaaagaggca
aggaccaaagagagcagatccagccctgccgtagagcagcaattgctagtgtcggggcca
gggaagaagccagaggattcccgagtgtga

DBGET integrated database retrieval system