KEGG   Homo sapiens (human): 11313
Entry
11313             CDS       T01001                                 

Gene name
LYPLA2, APT-2, APT2, DJ886K2.4
Definition
(RefSeq) lysophospholipase 2
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    11313 (LYPLA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     11313 (LYPLA2)
SSDB
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_6 Abhydrolase_3 Abhydrolase_1 Peptidase_S9 DLH Cutinase FSH1 DUF2974 Esterase_PHB Palm_thioest Esterase DUF2920 Lipase_3
Other DBs
NCBI-GeneID: 11313
NCBI-ProteinID: NP_009191
OMIM: 616143
HGNC: 6738
Ensembl: ENSG00000011009
Vega: OTTHUMG00000002961
Pharos: O95372(Tchem)
UniProt: O95372 A0A140VJC9
Structure
PDB: 
5SYN 6BJE

Position
1p36.11
AA seq 231 aa
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 696 nt   +upstreamnt  +downstreamnt
atgtgtggtaacaccatgtctgtgcccctgctcaccgatgctgccaccgtgtctggagct
gagcgggaaacggccgcggttatttttttacatggacttggagacacagggcacagctgg
gctgacgccctctccaccatccggctccctcacgtcaagtacatctgtccccatgcgcct
aggatccctgtgaccctcaacatgaagatggtgatgccctcctggtttgacctgatgggg
ctgagtccagatgccccagaggacgaggctggcatcaagaaggcagcagagaacatcaag
gccttgattgagcatgaaatgaagaacgggatccctgccaatcgaatcgtcctgggaggc
ttttcacagggcggggccctgtccctctacacggccctcacctgcccccaccctctggct
ggcatcgtggcgttgagctgctggctgcctctgcaccgggccttcccccaggcagctaat
ggcagtgccaaggacctggccatactccagtgccatggggagctggaccccatggtgccc
gtacggtttggggccctgacggctgagaagctccggtctgttgtcacacctgccagggtc
cagttcaagacatacccgggtgtcatgcacagctcctgtcctcaggagatggcagctgtg
aaggaatttcttgagaagctgctgcctcctgtctaa

DBGET integrated database retrieval system