KEGG   Homo sapiens (human): 113130Help
Entry
113130            CDS       T01001                                 

Gene name
CDCA5, SORORIN
Definition
(RefSeq) cell division cycle associated 5
  KO
K17390  sororin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    113130 (CDCA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    113130 (CDCA5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    113130 (CDCA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sororin
Motif
Other DBs
NCBI-GeneID: 113130
NCBI-ProteinID: NP_542399
OMIM: 609374
HGNC: 14626
Ensembl: ENSG00000146670
Vega: OTTHUMG00000150420
Pharos: Q96FF9(Tbio)
UniProt: Q96FF9 A0A024R5D6
Position
11q13.1
AA seq 252 aa AA seqDB search
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVL
KRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNP
EAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGV
SPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAE
FEAAEQFDLLVE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaggcgaacgcggtccggaggagccgctcagcgctccgggccaagggcccca
tctcctactaagcctctgcggaggtcccagcggaaatcaggctctgaactcccgagcatc
ctccctgaaatctggccgaagacacccagtgcggctgcagtcagaaagcccatcgtctta
aagaggatcgtggcccatgctgtagaggtcccagctgtccaatcacctcgcaggagccct
aggatttcctttttcttggagaaagaaaacgagccccctggcagggagcttactaaggag
gaccttttcaagacacacagcgtccctgccacccccaccagcactcctgtgccgaaccct
gaggccgagtccagctccaaggaaggagagctggacgccagagacttggaaatgtctaag
aaagtcaggcgttcctacagccggctggagaccctgggctctgcctctacctccacccca
ggccgccggtcctgctttggcttcgaggggctgctgggggcagaagacttgtccggagtc
tcgccagtggtgtgctccaaactcaccgaggtccccagggtttgtgcaaagccctgggcc
ccagacatgactctccctggaatctccccaccacccgagaaacagaaacgtaagaagaag
aaaatgccagagatcttgaaaacggagctggatgagtgggctgcggccatgaatgccgag
tttgaagctgctgagcagtttgatctcctggttgaatga

DBGET integrated database retrieval system