KEGG   Homo sapiens (human): 11315
Entry
11315             CDS       T01001                                 

Gene name
PARK7, DJ-1, DJ1, GATD2, HEL-S-67p
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05012  Parkinson disease
Network
nt06414  Apoptosis
nt06440  Transcription
nt06463  Parkinson disease
  Element
N01051  Mutation-inactivated DJ1 to intrinsic apoptotic pathway
N01057  Mutation-inactivated DJ1 to FAS-JNK signaling patwhay
N01058  Mutation-inactivated DJ1 to to p53-mediated transcription
N01059  Mutation-inactivated DJ1 to KEAP1-NRF2 signaling pathway
Disease
H00057  Parkinson disease
H01600  Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    11315 (PARK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    11315 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    11315 (PARK7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     11315 (PARK7)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C56: PfpI endopeptidase family
   11315 (PARK7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11315 (PARK7)
SSDB
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Other DBs
NCBI-GeneID: 11315
NCBI-ProteinID: NP_001116849
OMIM: 602533
HGNC: 16369
Ensembl: ENSG00000116288
Vega: OTTHUMG00000001210
Pharos: Q99497(Tbio)
UniProt: Q99497 V9HWC2
Structure
PDB: 

Position
1p36.23
AA seq 189 aa
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggctaaaggagcagaggaaatggagacggtc
atccctgtagatgtcatgaggcgagctgggattaaggtcaccgttgcaggcctggctgga
aaagacccagtacagtgtagccgtgatgtggtcatttgtcctgatgccagccttgaagat
gcaaaaaaagagggaccatatgatgtggtggttctaccaggaggtaatctgggcgcacag
aatttatctgagtctgctgctgtgaaggagatactgaaggagcaggaaaaccggaagggc
ctgatagccgccatctgtgcaggtcctactgctctgttggctcatgaaataggttttgga
agtaaagttacaacacaccctcttgctaaagacaaaatgatgaatggaggtcattacacc
tactctgagaatcgtgtggaaaaagacggcctgattcttacaagccgggggcctgggacc
agcttcgagtttgcgcttgcaattgttgaagccctgaatggcaaggaggtggcggctcaa
gtgaaggctccacttgttcttaaagactag

DBGET integrated database retrieval system