KEGG   Homo sapiens (human): 11316
Entry
11316             CDS       T01001                                 

Gene name
COPE, epsilon-COP
Definition
(RefSeq) COPI coat complex subunit epsilon
  KO
K17268  coatomer subunit epsilon
Organism
hsa  Homo sapiens (human)
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01293  COPI vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11316 (COPE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    11316 (COPE)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    11316 (COPE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11316 (COPE)
SSDB
Motif
Pfam: Coatomer_E TPR_19 TPR_14 ANAPC3 TPR_12 TPR_2 TPR_7 CysG_dimeriser TPR_16 TPR_1 Com_YlbF TPR_10
Other DBs
NCBI-GeneID: 11316
NCBI-ProteinID: NP_009194
OMIM: 606942
HGNC: 2234
Ensembl: ENSG00000105669
Vega: OTTHUMG00000183052
Pharos: O14579(Tbio)
UniProt: O14579
Position
19p13.11
AA seq 308 aa
MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAY
LAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFL
LMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDAT
LTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQ
EALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRL
VLQYAPSA
NT seq 927 nt   +upstreamnt  +downstreamnt
atggcgcctccggcccccggcccggcctccggcggctccggggaggtagacgagctgttc
gacgtaaagaacgccttctacatcggcagctaccagcagtgcataaacgaggcgcagcgg
gtgaagctatcaagcccagagagagacgtggagagggacgtcttcctgtatagagcgtac
ctggcgcagaggaagttcggtgtggtcctggatgagatcaagccctcctcggcccctgag
ctccaggccgtgcgcatgtttgctgactacctcgcccacgagagtcggagggacagcatc
gtggccgagctggaccgagagatgagcaggagcgtggacgtgaccaacaccaccttcctg
ctcatggccgcctccatctatctccacgaccagaacccggatgccgccctgcgtgcgctg
caccagggggacagcctggagtgcacagccatgacagtgcagatcctgctgaagctggac
cgcctggacctcgcccggaaggagctgaagagaatgcaggacctggacgaggatgccacc
ctcacccagctcgccactgcctgggtcagcctggccacgggtggtgagaagctgcaggat
gcctactacatcttccaggagatggctgacaagtgctcgcccaccctgctgctgctcaat
gggcaggcggcctgccacatggcccagggccgctgggaggccgctgagggcctgctgcag
gaggcgctagacaaggatagtggctacccagagacgctggtcaacctcatcgtcctgtcc
cagcacctgggcaagccccctgaggtgacaaaccgatacctgtcccagctgaaggatgcc
cacaggtcccatcccttcatcaaggagtaccaggccaaggagaacgactttgacaggctg
gtgctacagtacgctcccagcgcctga

DBGET integrated database retrieval system