KEGG   Homo sapiens (human): 11318Help
Entry
11318             CDS       T01001                                 

Gene name
GPR182, 7TMR, ADMR, AM-R, AMR, G10D, L1-R, gamrh, hrhAMR
Definition
(RefSeq) G protein-coupled receptor 182
  KO
K04242  adrenomedullin receptor
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Adrenomedullin (G10D)
    11318 (GPR182)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 11318
NCBI-ProteinID: NP_009195
OMIM: 605307
HGNC: 13708
Ensembl: ENSG00000166856
Vega: OTTHUMG00000171005
Pharos: O15218(Tbio)
UniProt: O15218
Position
12q13.3
AA seq 404 aa AA seqDB search
MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALY
LAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWL
WGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVL
SAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVL
TACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYF
FYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHS
IIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgaaacccagctgggggcctggcccctcggagggggtcaccgcagtgcctacc
agtgaccttggagagatccacaactggaccgagctgcttgacctcttcaaccacactttg
tctgagtgccacgtggagctcagccagagcaccaagcgcgtggtcctctttgccctctac
ctggccatgtttgtggttgggctggtggagaacctcctggtgatatgcgtcaactggcgc
ggctcaggccgggcagggctgatgaacctctacatcctcaacatggccatcgcggacctg
ggcattgtcctgtctctgcccgtgtggatgctggaggtcacgctggactacacctggctc
tggggcagcttctcctgccgcttcactcactacttctactttgtcaacatgtatagcagc
atcttcttcctggtgtgcctcagtgtcgaccgctatgtcaccctcaccagcgcctccccc
tcctggcagcgttaccagcaccgagtgcggcgggccatgtgtgcaggcatctgggtcctc
tcggccatcatcccgctgcctgaggtggtccacatccagctggtggagggccctgagccc
atgtgcctcttcatggcaccttttgaaacgtacagcacctgggccctggcggtggccctg
tccaccaccatcctgggcttcctgctgcccttccctctcatcacagtcttcaatgtgctg
acagcctgccggctgcggcagccaggacaacccaagagccggcgccactgcctgctgctg
tgcgcctacgtggccgtctttgtcatgtgctggctgccctatcatgtgaccctgctgctg
ctcacactgcatgggacccacatctccctccactgccacctggtccacctgctctacttc
ttctatgatgtcattgactgcttctccatgctgcactgtgtcatcaaccccatcctttac
aactttctcagcccacacttccggggccggctcctgaatgctgtagtccattaccttcct
aaggaccagaccaaggcgggcacatgcgcctcctcttcctcctgttccacccagcattcc
atcatcatcaccaagggtgatagccagcctgctgcagcagccccccaccctgagccaagc
ctgagctttcaggcacaccatttgcttccaaatacttcccccatctctcccactcagcct
cttacacccagctga

DBGET integrated database retrieval system