KEGG   Homo sapiens (human): 11320Help
Entry
11320             CDS       T01001                                 

Gene name
MGAT4A, GNT-IV, GNT-IVA, GnT-4a
Definition
(RefSeq) alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
  KO
K00738  alpha-1,3-mannosylglycoprotein beta-1,4-N-acetylglucosaminyltransferase A/B [EC:2.4.1.145]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    11320 (MGAT4A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    11320 (MGAT4A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.145  alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     11320 (MGAT4A)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   11320 (MGAT4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_54 DUF4750
Motif
Other DBs
NCBI-GeneID: 11320
NCBI-ProteinID: NP_036346
OMIM: 604623
HGNC: 7047
Ensembl: ENSG00000071073
Vega: OTTHUMG00000130563
Pharos: Q9UM21(Tbio)
UniProt: Q9UM21
Position
2q11.2
AA seq 535 aa AA seqDB search
MRLRNGTVATALAFITSFLTLSWYTTWQNGKEKLIAYQREFLALKERLRIAEHRISQRSS
ELNTIVQQFKRVGAETNGSKDALNKFSDNTLKLLKELTSKKSLQVPSIYYHLPHLLKNEG
SLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGET
DIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNL
DYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMF
QAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQ
HVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWA
ITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDK
RLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccgcaatggaactgtagccactgctttagcatttatcacttccttccttact
ttgtcttggtatactacatggcaaaatgggaaagaaaaactgattgcttatcaacgagaa
ttccttgctttgaaagaacgtcttcgaatagctgaacacagaatctcacagcgctcttct
gaattaaatacgattgtgcaacagttcaagcgtgtaggagcagaaacaaatggaagtaag
gatgcgttgaataagttttcagataataccctaaagctgttaaaggagttaacaagcaaa
aaatctcttcaagtgccaagtatttattatcatttgcctcatttattgaaaaatgaagga
agtcttcaacctgctgtacagattggcaacggaagaacaggagtttcaatagtcatgggc
attcccacagtgaagagagaagttaaatcttacctcatagaaactcttcattcccttatt
gataacctgtatcctgaagagaagttggactgtgttatagtagtcttcataggagagaca
gatattgattatgtacatggtgttgtagccaacctggagaaagaattttctaaagaaatc
agttctggcttggtggaagtcatatcaccccctgaaagctattatcctgacttgacaaac
ctaaaggagacatttggagactccaaagaaagagtaagatggagaacaaagcaaaaccta
gattactgttttctaatgatgtatgctcaagaaaagggcatatattacattcagcttgaa
gatgatattattgtcaaacaaaattattttaataccataaaaaattttgcacttcaactt
tcttctgaggaatggatgattctagagttttcccagctgggcttcattggtaaaatgttt
caagcgccggatcttactctgattgtagaattcatattcatgttttacaaggagaaaccc
attgattggctcctggaccatattctctgggtgaaagtctgcaaccctgaaaaagatgca
aaacattgtgatagacagaaagcaaatctgcgaattcgcttcagaccttcccttttccaa
catgttggtctgcactcatcactatcaggaaaaatccaaaaactcacggataaagattat
atgaaaccattacttcttaaaatccatgtaaacccacctgcggaggtatctacttccttg
aaggtctaccaagggcatacgctggagaaaacttacatgggagaggatttcttctgggct
atcacaccgatagctggagactacatcttgtttaaatttgataaaccagtcaatgtagaa
agttatttgttccatagcggcaaccaagaacatcctggagatattctgctaaacacaact
gtggaagttttgccttttaagagtgaaggtttggaaataagcaaagaaaccaaagacaaa
cgattagaagatggctatttcagaataggaaaatttgagaatggtgttgcagaaggaatg
gtggatccaagtctcaatcccatttcagcctttcgactttcagttattcagaattctgct
gtttgggccattcttaatgagattcatattaaaaaagccaccaactga

DBGET integrated database retrieval system