KEGG   Homo sapiens (human): 113235Help
Entry
113235            CDS       T01001                                 

Gene name
SLC46A1, G21, HCP1, PCFT
Definition
(RefSeq) solute carrier family 46 member 1
  KO
K14613  MFS transporter, PCFT/HCP family, solute carrier family 46 (folate transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04977  Vitamin digestion and absorption
hsa04978  Mineral absorption
Disease
H01252  Hereditary folate malabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    113235 (SLC46A1)
   04978 Mineral absorption
    113235 (SLC46A1)
 09160 Human Diseases
  09176 Drug resistance: Antineoplastic
   01523 Antifolate resistance
    113235 (SLC46A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    113235 (SLC46A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC46: Folate transporter
   113235 (SLC46A1)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Proton coupled folate transporter/heme carrier protein (PCFT/HCP) family [TC:2.A.1.50]
    113235 (SLC46A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 113235
NCBI-ProteinID: NP_542400
OMIM: 611672
HGNC: 30521
Ensembl: ENSG00000076351
Vega: OTTHUMG00000179415
Pharos: Q96NT5(Tchem)
UniProt: Q96NT5 A0A024QZ15
Position
17q11.2
AA seq 459 aa AA seqDB search
MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGT
RQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLA
SLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFR
MALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKST
RLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWD
SKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFT
GYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNF
MKGFPFLLGAGLLLIPAVLIGMLEKADPHLEFQQFPQSP
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggaggggagcgcgagccccccggaaaagccccgcgcccgccctgcggctgccgtgctg
tgccggggcccggtagagccgctggtcttcctggccaactttgccttggtcctgcagggc
ccgctcaccacgcagtatctgtggcaccgcttcagcgccgacctcggctacaatggcacc
cgccaaagggggggctgcagcaaccgcagcgcggaccccaccatgcaggaagtggagacc
cttacctcccactggaccctctacatgaacgtgggcggcttcctggtggggctcttctcg
tccaccctgctgggagcttggagcgacagtgtgggccgccgcccgctgctagtgctggcc
tcgctgggcctgctgctccaggccctagtgtccgtttttgtggtgcagctgcagctccac
gtcggctacttcgtgctgggtcgcatcctttgtgccctcctcggcgacttcggtggcctt
ctggctgctagctttgcgtccgtggcagatgtcagctccagtcgcagccgcaccttccgg
atggccctgctggaagccagcatcggggtggctgggatgctggcaagcctcctcgggggc
cactggctccgggcccagggttatgccaaccccttctggctggccttggccttgctgata
gccatgactctctatgcagctttctgctttggtgagaccttaaaggagccaaagtccacc
cggctcttcacgttccgtcaccaccgatccattgtccagctctatgtggctcccgcccca
gagaagtccaggaaacatttagccctctactcactggccatcttcgtggtgatcactgtg
cactttggggcccaggacatcttaaccctttatgaactaagcacacccctctgctgggac
tccaaactaatcggctatggttctgcagctcagcatctcccctacctcaccagcctgctg
gccctgaagctcctgcagtactgcctggccgatgcctgggtagctgagatcggcctggcc
ttcaacatcctggggatggtggtctttgcctttgccactatcacgcctctcatgttcaca
ggatatgggttgcttttcctgtcattagtcatcacacctgtcatccgggctaaactctcc
aagctggtgagagagacagagcagggtgctctcttttctgctgtggcctgtgtgaatagc
ctggccatgctgacggcctccggcatcttcaactcactctacccagccactctgaacttt
atgaaggggttccccttcctcctgggagctggcctcctgctcatcccggctgttctgatt
gggatgctggaaaaggctgatcctcacctcgagttccagcagtttccccagagcccctga

DBGET integrated database retrieval system