KEGG   Homo sapiens (human): 11325Help
Entry
11325             CDS       T01001                                 

Gene name
DDX42, DDX42P, RHELP, RNAHP, SF3B8, SF3b125
Definition
(RefSeq) DEAD-box helicase 42
  KO
K12835  ATP-dependent RNA helicase DDX42 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    11325 (DDX42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    11325 (DDX42)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     11325 (DDX42)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    11325 (DDX42)
 Complex B
    11325 (DDX42)
 Complex C
   U2 SnRNP specific factors
    11325 (DDX42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 11325
NCBI-ProteinID: NP_031398
OMIM: 613369
HGNC: 18676
Ensembl: ENSG00000198231
Vega: OTTHUMG00000179011
Pharos: Q86XP3(Tdark)
UniProt: Q86XP3
Position
17q23.3
AA seq 938 aa AA seqDB search
MNWNKGGPGTKRGFGFGGFAISAGKKEEPKLPQQSHSAFGATSSSSGFGKSAPPQLPSFY
KIGSKRANFDEENAYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVDSDSDDDPLEAFM
AEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYMAENPTAGVVQEEEEDN
LEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLN
LRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTG
SGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAV
YGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQ
VRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHS
GPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKV
ISDFKKKDIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYT
LLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQNAWFRKSRFKGGKGKKLNIGGGGLGY
RERPGLGSENMDRGNNNVMSNYEAYKPSTGAMGDRLTAMKAAFQSQYKSHFVAASLSNQK
AGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAAKGIPGFGNTGNISGAPVTYP
SAGAQGVNNTASGNNSREGTGGSNGKRERYTENRGSSRHSHGETGNRHSDSPRHGDGGRH
GDGYRHPESSSRHTDGHRHGENRHGGSAGRHGENRGANDGRNGESRKEAFNRESKMEPKM
EPKVDSSKMDKVDSKTDKTADGFAVPEPPKRKKSRWDS
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaataaaggtggtcctggcactaagcgaggatttggctttggaggttttgcc
atcagtgctgggaaaaaggaggaacccaaactcccacagcagtcccacagtgcctttggg
gcaaccagctcttcttctggatttggaaagtcagctccaccacagcttccttctttctac
aaaattggatctaagcgggccaactttgatgaagaaaatgcctattttgaagatgaggaa
gaagattctagcaacgttgatttaccttacattcctgctgaaaactcaccaactcgccag
caattccattccaagccagtagattctgacagcgatgatgatcccttggaggcattcatg
gctgaagtggaggatcaggcagctagagacatgaagaggcttgaagaaaaggacaaggaa
agaaaaaacgtaaagggtattcgagatgacattgaagaggaagatgaccaagaagcttat
tttcgatacatggcagaaaacccaactgctggtgtggttcaggaggaagaggaagacaat
ctagaatatgatagtgacggaaatccaattgcacctaccaaaaaaatcattgatcctctt
ccccccattgatcattcagagattgactatccaccatttgaaaaaaacttttacaatgag
catgaagagataaccaacctcactccacagcagttaatagatctccggcataagctcaat
cttcgggtctctggtgctgcacctcctagaccaggaagtagctttgctcattttgggttt
gacgaacaacttatgcaccagattcggaaatctgaatacacacagcccactccaatacag
tgccagggtgtgcctgtggcattaagtggtagagacatgattggtattgccaaaacaggt
agtgggaaaactgcagccttcatttggcccatgttgattcatataatggaccagaaggag
ttggaaccaggtgatggaccaattgcagtgattgtgtgtcctaccagggagctttgccag
cagatccatgcagaatgtaagcggtttggaaaagcatataatcttcgatcagtggccgta
tatggaggagggagtatgtgggagcaggccaaggcccttcaggagggggcagagattgtt
gtgtgtaccccaggtcgactgatagatcatgtgaaaaagaaagctaccaatcttcaaaga
gtctcttaccttgtgtttgatgaagcagatcgaatgtttgacatgggatttgagtaccaa
gttcgatccatagcaagtcatgttcgtcctgacaggcagactctcttatttagtgcaact
tttcggaagaagattgaaaagttggccagagacatcctgatcgaccctattcgagtggtg
cagggagatattggagaggcaaatgaagatgtgacacagattgtggagattctccattct
ggacctagtaaatggaactggcttacccggcgtctggtagaatttacctcttcagggagt
gtcctcctctttgttactaaaaaagccaatgctgaagagctagcgaataaccttaaacag
gagggtcataatcttgggctgctccatggggatatggatcagagtgagagaaacaaggtc
atttcagactttaagaaaaaggacatcccagtcctggtggccacagatgttgcagcccgt
ggtctggacattccttcaattaagactgtcattaactatgatgtggcacgagacattgat
acccacacgcataggattggccgcacaggaagagcgggtgagaaaggtgtggcctatacc
ctactcactcccaaggacagcaattttgctggtgacctggtccggaacttggaaggagcc
aatcaacacgtttctaaggaactcctagatctggcaatgcagaatgcctggtttcggaaa
tctcgattcaaaggagggaaaggaaaaaagctgaacattggtggaggaggcctaggctac
agggagcggcctggcctgggctctgagaacatggatcgaggaaataacaatgtaatgagc
aattatgaggcctacaagccttccacaggagctatgggagatcgactaacggcaatgaaa
gcagctttccagtcacagtacaagagtcactttgttgcagccagtttaagtaatcagaag
gctggaagttctgctgctggggcaagtgggtggactagtgcagggagcttgaattctgtt
ccaactaactcagcacaacagggccataacagtcctgacagccccgtcaccagtgccgcc
aagggcatcccaggctttggcaatactggcaacatcagtggtgcccctgtgacctacccg
tctgccggagcccaaggagtcaacaacacagcttcagggaataacagccgagaagggact
gggggcagcaacgggaaaagagagagatatactgagaaccggggcagcagccgtcacagt
cacggagagactggcaatcggcatagcgatagtccacgtcacggagatggtggtcgccat
ggagatggataccgccatccagaaagcagcagccgtcatactgatggccatcggcacggg
gagaacagacatggaggaagcgcaggccggcatggggagaaccggggtgcaaatgatggt
cggaatggggaaagcaggaaagaagcttttaatcgtgagagcaagatggagcccaagatg
gaacccaaagtggacagcagcaagatggacaaggtggacagcaagacagataagacagct
gacggctttgctgtcccagagccgcctaaacgcaagaaaagtcgatgggacagttag

DBGET integrated database retrieval system