KEGG   Homo sapiens (human): 11326Help
Entry
11326             CDS       T01001                                 

Gene name
VSIG4, CRIg, Z39IG
Definition
(RefSeq) V-set and immunoglobulin domain containing 4
  KO
K19822  V-set and immunoglobulin domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    11326 (VSIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 Ig_2 I-set ig Ig_C17orf99 Ig_6 Izumo-Ig V-set_CD47 Rax2
Motif
Other DBs
NCBI-GeneID: 11326
NCBI-ProteinID: NP_009199
OMIM: 300353
HGNC: 17032
Ensembl: ENSG00000155659
Vega: OTTHUMG00000021727
Pharos: Q9Y279(Tbio)
UniProt: Q9Y279
Structure
PDB: 

Position
Xq12
AA seq 399 aa AA seqDB search
MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQR
GSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTP
DGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQ
QTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
MAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDE
PCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggggatcttactgggcctgctactcctggggcacctaacagtggacacttatggccgt
cccatcctggaagtgccagagagtgtaacaggaccttggaaaggggatgtgaatcttccc
tgcacctatgaccccctgcaaggctacacccaagtcttggtgaagtggctggtacaacgt
ggctcagaccctgtcaccatctttctacgtgactcttctggagaccatatccagcaggca
aagtaccagggccgcctgcatgtgagccacaaggttccaggagatgtatccctccaattg
agcaccctggagatggatgaccggagccactacacgtgtgaagtcacctggcagactcct
gatggcaaccaagtcgtgagagataagattactgagctccgtgtccagaaactctctgtc
tccaagcccacagtgacaactggcagcggttatggcttcacggtgccccagggaatgagg
attagccttcaatgccaggctcggggttctcctcccatcagttatatttggtataagcaa
cagactaataaccaggaacccatcaaagtagcaaccctaagtaccttactcttcaagcct
gcggtgatagccgactcaggctcctatttctgcactgccaagggccaggttggctctgag
cagcacagcgacattgtgaagtttgtggtcaaagactcctcaaagctactcaagaccaag
actgaggcacctacaaccatgacataccccttgaaagcaacatctacagtgaagcagtcc
tgggactggaccactgacatggatggctaccttggagagaccagtgctgggccaggaaag
agcctgcctgtctttgccatcatcctcatcatctccttgtgctgtatggtggtttttacc
atggcctatatcatgctctgtcggaagacatcccaacaagagcatgtctacgaagcagcc
agggcacatgccagagaggccaacgactctggagaaaccatgagggtggccatcttcgca
agtggctgctccagtgatgagccaacttcccagaatctgggcaacaactactctgatgag
ccctgcataggacaggagtaccagatcatcgcccagatcaatggcaactacgcccgcctg
ctggacacagttcctctggattatgagtttctggccactgagggcaaaagtgtctgttaa

DBGET integrated database retrieval system