KEGG   Homo sapiens (human): 11328Help
Entry
11328             CDS       T01001                                 

Gene name
FKBP9, FKBP60, FKBP63, PPIase
Definition
(RefSeq) FKBP prolyl isomerase 9
  KO
K09575  FK506-binding protein 9/10 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    11328 (FKBP9)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     11328 (FKBP9)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    11328 (FKBP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 11328
NCBI-ProteinID: NP_009201
OMIM: 616257
HGNC: 3725
Ensembl: ENSG00000122642
Vega: OTTHUMG00000097847
Pharos: O95302(Tdark)
UniProt: O95302 A7YQ73
Position
7p14.3
AA seq 570 aa AA seqDB search
MAFRGWRPPPPPLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYH
YVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGNE
GVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDG
TLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPG
QASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYS
RNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIH
VIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVL
GSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGL
PEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKN
MFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccggggctggaggcccccgccgccaccgctgctcctgctgctgctctgggtg
accgggcaggcagcgcccgtggcgggcctgggctccgacgcggagctgcagatcgagcgg
cgcttcgtgcccgacgagtgcccgcgcaccgtgcgcagcggcgacttcgtgcgctaccac
tacgtggggacgttccccgacggccagaagttcgactccagctatgacagagactccact
ttcaatgtgtttgtgggaaaaggacagctgatcacagggatggaccaggctcttgttggg
atgtgcgtaaacgagagacgtttcgtgaagattcccccaaagcttgcctacggaaatgaa
ggagtttctggtgtgatcccccccaattcagtgcttcattttgatgtacttctgatggat
atttggaattctgaagaccaggttcagattcacacctatttcaagcccccgagttgccct
cggaccatccaggtgtctgattttgtgaggtaccactacaacgggacgttcctggacgga
actctgtttgattcgagtcacaatcgcatgaaaacatatgacacgtatgtgggaattggc
tggctgattcctggaatggataaagggctgctggggatgtgtgtgggtgagaagcgcatc
atcaccattcctccttttctggcctatggagaggatggagatgggaaagacattcccggt
caggcatctctggtgtttgatgttgcattattggacctccataaccccaaggacagcatt
tccattgagaacaaggtagtacctgaaaactgtgagcggataagtcaaagtggggacttt
ctcaggtatcattacaatggcacgcttctggatggcaccctctttgattccagctactct
cggaaccgcacgtttgacacgtacattgggcagggctacgtgattcctgggatggatgaa
ggtctacttggtgtttgcattggagaaaagcgaaggattgtggtcccgcctcacctgggg
tatggagaggaaggaagagggaatatccccggctcggctgtgctggtgtttgacatccat
gtgatcgacttccacaacccttcggactccatcagcatcacctcccactacaaaccccct
gactgctcagtgctgagtaagaagggagattacctcaaatatcactacaatgcctcactt
ctggatgggaccctgctggactccacgtggaatttaggcaaaacttacaatattgttctg
ggatctgggcaagttgtgttggggatggacatgggtctcagagagatgtgcgttggcgag
aaacggacagtgatcattccgcctcacctgggctatggggaagctggcgtggatggagaa
gtgcccggcagtgccgtattagtgtttgacattgagctgctggagctggtggctggcctt
cctgaggggtacatgttcatatggaatggtgaggtgtcacccaacctctttgaagaaatt
gacaaggatggcaacggagaagtcctcctggaagagttctcagagtacattcacgcccag
gtggcatctggcaaagggaaactcgctcctggctttgatgctgagctgattgtgaagaat
atgttcaccaaccaggaccggaatggagatgggaaggtcacagccgaggaatttaaactc
aaagaccaggaagccaaacacgatgaactctaa

DBGET integrated database retrieval system