KEGG   Homo sapiens (human): 11331Help
Entry
11331             CDS       T01001                                 

Gene name
PHB2, BAP, BCAP37, Bap37, PNAS-141, REA, hBAP, p22
Definition
(RefSeq) prohibitin 2
  KO
K17081  prohibitin 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    11331 (PHB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    11331 (PHB2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    11331 (PHB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   11331 (PHB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Med2 DUF2605
Motif
Other DBs
NCBI-GeneID: 11331
NCBI-ProteinID: NP_001138303
OMIM: 610704
HGNC: 30306
Ensembl: ENSG00000215021
Vega: OTTHUMG00000168519
Pharos: Q99623(Tbio)
UniProt: Q99623
Position
12p13.31
AA seq 299 aa AA seqDB search
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQ
DTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSM
YQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILD
DVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGE
ALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaacttgaaggacttggcgggacggctgcccgccgggccccggggcatgggc
acggccctgaagctgttgctgggggccggcgccgtggcctacggtgtgcgcgaatctgtg
ttcaccgtggaaggcgggcacagagccatcttcttcaatcggatcggtggagtgcagcag
gacactatcctggccgagggccttcacttcaggatcccttggttccagtaccccattatc
tatgacattcgggccagacctcgaaaaatctcctcccctacaggctccaaagacctacag
atggtgaatatctccctgcgagtgttgtctcgacccaatgctcaggagcttcctagcatg
taccagcgcctagggctggactacgaggaacgagtgttgccgtccattgtcaacgaggtg
ctcaagagtgtggtggccaagttcaatgcctcacagctgatcacccagcgggcccaggta
tccctgttgatccgccgggagctgacagagagggccaaggacttcagcctcatcctggat
gatgtggccatcacagagctgagctttagccgagagtacacagctgctgtagaagccaaa
caagtggcccagcaggaggcccagcgggcccaattcttggtagaaaaagcaaagcaggaa
cagcggcagaaaattgtgcaggccgagggtgaggccgaggctgccaagatgcttggagaa
gcactgagcaagaaccctggctacatcaaacttcgcaagattcgagcagcccagaatatc
tccaagacgatcgccacatcacagaatcgtatctatctcacagctgacaaccttgtgctg
aacctacaggatgaaagtttcaccaggggaagtgacagcctcatcaagggtaagaaatga

DBGET integrated database retrieval system