KEGG   Homo sapiens (human): 11334Help
Entry
11334             CDS       T01001                                 

Gene name
TUSC2, C3orf11, FUS1, PAP, PDAP2
Definition
(RefSeq) tumor suppressor 2, mitochondrial calcium regulator
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TUSC2
Motif
Other DBs
NCBI-GeneID: 11334
NCBI-ProteinID: NP_009206
OMIM: 607052
HGNC: 17034
Ensembl: ENSG00000114383
Vega: OTTHUMG00000156877
Pharos: O75896(Tbio)
UniProt: O75896
Position
3p21.31
AA seq 110 aa AA seqDB search
MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA
HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccagcgggtccaaagctcggggcctgtggcccttcgcctcggcggccggaggc
ggcggctcagaggcagcaggagctgagcaagctttggtgcggcctcggggccgagctgtg
ccccccttcgtattcacgcgccgcggctctatgttctatgatgaggatggggatctggct
cacgagttctatgaggagacaatcgtcaccaagaacgggcagaagcgggccaagctgagg
cgagtgcataagaatctgattcctcagggcatcgtgaagctggatcacccccgcatccac
gtggatttccctgtgatcctctatgaggtgtga

DBGET integrated database retrieval system