KEGG   Homo sapiens (human): 11338Help
Entry
11338             CDS       T01001                                 

Gene name
U2AF2, U2AF65
Definition
(RefSeq) U2 small nuclear RNA auxiliary factor 2
  KO
K12837  splicing factor U2AF 65 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    11338 (U2AF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    11338 (U2AF2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    11338 (U2AF2)
 Complex B
    11338 (U2AF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded RRM_7 Transformer
Motif
Other DBs
NCBI-GeneID: 11338
NCBI-ProteinID: NP_009210
OMIM: 191318
HGNC: 23156
Ensembl: ENSG00000063244
Vega: OTTHUMG00000180908
Pharos: P26368(Tbio)
UniProt: P26368
Structure
PDB: 

Position
19q13.42
AA seq 475 aa AA seqDB search
MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR
RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA
LLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ
APGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
NPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK
GYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQV
PGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacttcgacgagttcgagcggcagctcaacgagaataaacaagagcgggacaag
gagaaccggcatcggaagcgcagccacagccgctctcggagccgggaccgcaaacgccgg
agccggagccgcgaccggcgcaaccgggaccagcggagcgcctcccgggacaggcgacga
cgcagcaaacctttgaccagaggcgctaaagaggagcacggtggactgattcgttccccc
cgccacgagaagaagaagaaggtccgtaaatactgggacgtgccacccccaggctttgag
cacatcaccccaatgcagtacaaggccatgcaagctgcgggtcagattccagccactgct
cttctccccaccatgacccctgacggtctggctgtgaccccaacgccggtgcccgtggtc
gggagccagatgaccagacaagcccggcgcctctacgtgggcaacatcccctttggcatc
actgaggaggccatgatggatttcttcaacgcccagatgcgcctgggggggctgacccag
gcccctggcaacccagtgttggctgtgcagattaaccaggacaagaattttgcctttttg
gagttccgctcagtggacgagactacccaggctatggcctttgatggcatcatcttccag
ggccagtcactaaagatccgcaggcctcacgactaccagccgcttcctggcatgtcagag
aacccctccgtctatgtgcctggggttgtgtccactgtggtccccgactctgcccacaag
ctgttcatcgggggcttacccaactacctgaacgatgaccaggtcaaagagctgctgaca
tcctttgggcccctcaaggccttcaacctggtcaaggacagtgccacggggctctccaag
ggctacgccttctgtgagtacgtggacatcaacgtcacggatcaggccattgcggggctg
aacggcatgcagctgggggataagaagctgctggtccagagggcgagtgtgggagccaag
aatgccacgctggtgagccccccgagcaccatcaatcagacgcctgtgaccctgcaagtg
ccgggcttgatgagctcccaggtgcagatgggcggccacccgactgaggtcctgtgcctc
atgaacatggtgctgcctgaggagctgctggacgacgaggagtatgaggagatcgtggag
gatgtgcgggacgagtgcagcaagtacgggcttgtcaagtccatcgagatcccccggcct
gtggacggcgtcgaggtgcccggctgcggaaagatctttgtggagttcacctctgtgttt
gactgccagaaagccatgcagggcctgacgggccgcaagttcgccaacagagtggttgtc
acaaaatactgtgaccccgactcttatcaccgccgggacttctggtag

KEGG   Homo sapiens (human): 7307Help
Entry
7307              CDS       T01001                                 

Gene name
U2AF1, FP793, RN, RNU2AF1, U2AF35, U2AFBP
Definition
(RefSeq) U2 small nuclear RNA auxiliary factor 1
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05131  Shigellosis
Disease
H01481  Myelodysplastic syndrome (MDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    7307 (U2AF1)
 09160 Human Diseases
  09167 Infectious diseases
   05131 Shigellosis
    7307 (U2AF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    7307 (U2AF1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    7307 (U2AF1)
 Complex B
    7307 (U2AF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH RRM_1 Torus KMP11 Nup35_RRM_2 zf-CCCH_3
Motif
Other DBs
NCBI-GeneID: 7307
NCBI-ProteinID: NP_001020374
OMIM: 191317
HGNC: 12453
Ensembl: ENSG00000160201
Vega: OTTHUMG00000086836
Pharos: Q01081(Tbio)
UniProt: Q01081
Position
21q22.3
AA seq 240 aa AA seqDB search
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ
TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtatctggcctccatcttcggcaccgagaaagacaaagtcaactgttcattt
tatttcaaaattggagcatgtcgtcatggagacaggtgctctcggttgcacaataaaccg
acgtttagccagaccatcttgattcaaaacatctatcgtaatccccaaaacagtgcacag
acggctgacggctcacactgtgccgtgagcgatgtggagatgcaggaacactatgatgag
ttttttgaggaggtttttacagaaatggaggagaagtatggggaagtagaggagatgaac
gtctgtgacaacctgggagaccacctggtggggaacgtgtacgtcaagtttcgccgtgag
gaagatgcggaaaaggctgtgattgacttgaataaccgttggtttaatggacagccgatc
cacgccgagctgtcacccgtgacggacttcagagaagcctgctgccgtcagtatgagatg
ggagaatgcacacgaggcggcttctgcaacttcatgcatttgaagcccatttccagagag
ctgcggcgggagctgtatggccgccgtcgcaagaagcatagatcaagatcccgatcccgg
gagcgtcgttctcggtctagagaccgtggtcgtggcggtggcggtggcggtggtggaggt
ggcggcggacgggagcgtgacaggaggcggtcgagagatcgtgaaagatctgggcgattc
tga

DBGET integrated database retrieval system