KEGG   Homo sapiens (human): 11339
Entry
11339             CDS       T01001                                 
Symbol
OIP5, 5730547N13Rik, CT86, LINT-25, MIS18B, MIS18beta, hMIS18beta
Name
(RefSeq) Opa interacting protein 5
  KO
K11565  opa-interacting protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    11339 (OIP5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     11339 (OIP5)
SSDB
Motif
Pfam: Yippee-Mis18
Other DBs
NCBI-GeneID: 11339
NCBI-ProteinID: NP_009211
OMIM: 606020
HGNC: 20300
Ensembl: ENSG00000104147
Pharos: O43482(Tbio)
UniProt: O43482 A0A024R9N0
Position
15:complement(41309273..41332591)
AA seq 229 aa
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEP
AAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFL
VGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIV
NASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcggctcagccgctgcggcatcgctcacgttgtgcaacgccgccccggggggacttt
tgtggtggcactgagagggcgattgaccaagcttcttttacgacctccatggagtgggat
acgcaggtggtgaaggggtcctcgccgctcggccccgcagggctgggggctgaggagcca
gccgccggcccgcagctgccgtcttggctgcagcctgagaggtgcgctgtgttccagtgc
gcacagtgtcacgcagtgctcgccgactcggtgcacctcgcctgggacctgtcgcggtcc
ctcggggccgtggtcttctccagagttacaaataacgtcgttttggaagcgcccttccta
gttggcattgaaggttcactcaaaggcagtacttacaaccttttattctgtggttcttgt
gggattcccgttggtttccatctgtattctacccatgctgccctggctgccttgagaggt
cacttctgcctttccagtgacaaaatggtgtgctatctcttaaaaacaaaagccatagta
aatgcatcagagatggatattcaaaatgttcctctatcagaaaagattgcagagctgaaa
gagaagatagtgctaacgcacaatcgcttaaaatcactaatgaagattctgagtgaagtg
actcctgaccagtccaagccagaaaactga

DBGET integrated database retrieval system