KEGG   Homo sapiens (human): 1135
Entry
1135              CDS       T01001                                 

Gene name
CHRNA2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 2 subunit
  KO
K04804  nicotinic acetylcholine receptor alpha-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1135 (CHRNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1135 (CHRNA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1135 (CHRNA2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Atrophin-1 DUF2417
Other DBs
NCBI-GeneID: 1135
NCBI-ProteinID: NP_000733
OMIM: 118502
HGNC: 1956
Ensembl: ENSG00000120903
Vega: OTTHUMG00000102083
Pharos: Q15822(Tchem)
UniProt: Q15822
Structure
PDB: 
5FJV

Position
8p21.2
AA seq 529 aa
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgggcccctcctgtcctgtgttcctgtccttcacaaagctcagcctgtggtggctcctt
ctgaccccagcaggtggagaggaagctaagcgcccacctcccagggctcctggagaccca
ctctcctctcccagtcccacggcattgccgcagggaggctcgcataccgagactgaggac
cggctcttcaaacacctcttccggggctacaaccgctgggcgcgcccggtgcccaacact
tcagacgtggtgattgtgcgctttggactgtccatcgctcagctcatcgatgtggatgag
aagaaccaaatgatgaccaccaacgtctggctaaaacaggagtggagcgactacaaactg
cgctggaaccccactgattttggcaacatcacatctctcagggtcccttctgagatgatc
tggatccccgacattgttctctacaacaatgcagatggggagtttgcagtgacccacatg
accaaggcccacctcttctccacgggcactgtgcactgggtgcccccggccatctacaag
agctcctgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaagatgaag
tttggctcctggacttatgacaaggccaagatcgacctggagcagatggagcagactgtg
gacctgaaggactactgggagagcggcgagtgggccatcgtcaatgccacgggcacctac
aacagcaagaagtacgactgctgcgccgagatctaccccgacgtcacctacgccttcgtc
atccggcggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcc
tgcctcactgtgctggtcttctacctgccctccgactgcggcgagaagatcacgctgtgc
atttcggtgctgctgtcactcaccgtcttcctgctgctcatcactgagatcatcccgtcc
acctcgctggtcatcccgctcatcggcgagtacctgctgttcaccatgatcttcgtcacc
ctgtccatcgtcatcaccgtcttcgtgctcaatgtgcaccaccgctcccccagcacccac
accatgccccactgggtgcggggggcccttctgggctgtgtgccccggtggcttctgatg
aaccggcccccaccacccgtggagctctgccaccccctacgcctgaagctcagcccctct
tatcactggctggagagcaacgtggatgccgaggagagggaggtggtggtggaggaggag
gacagatgggcatgtgcaggtcatgtggccccctctgtgggcaccctctgcagccacggc
cacctgcactctggggcctcaggtcccaaggctgaggctctgctgcaggagggtgagctg
ctgctatcaccccacatgcagaaggcactggaaggtgtgcactacattgccgaccacctg
cggtctgaggatgctgactcttcggtgaaggaggactggaagtatgttgccatggtcatc
gacaggatcttcctctggctgtttatcatcgtctgcttcctggggaccatcggcctcttt
ctgcctccgttcctagctggaatgatctga

DBGET integrated database retrieval system