KEGG   Homo sapiens (human): 113612
Entry
113612            CDS       T01001                                 

Symbol
CYP2U1, P450TEC, SPG49, SPG56
Name
(RefSeq) cytochrome P450 family 2 subfamily U member 1
  KO
K07422  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113612 (CYP2U1)
   00590 Arachidonic acid metabolism
    113612 (CYP2U1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    113612 (CYP2U1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     113612 (CYP2U1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   113612 (CYP2U1)
SSDB
Motif
Pfam: p450 DUF5081
Other DBs
NCBI-GeneID: 113612
NCBI-ProteinID: NP_898898
OMIM: 610670
HGNC: 20582
Ensembl: ENSG00000155016
Vega: OTTHUMG00000161084
Pharos: Q7Z449(Tbio)
UniProt: Q7Z449
Position
4q25
AA seq 544 aa
MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGIP
PGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSF
FIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKF
SHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQR
FDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLPFGPFKELRQIEKDITSFLKK
IIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNS
LLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLA
IPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETF
IPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNIT
ISRR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcgtctccggggccgtcgcagccgccggccgaggacccgccctggcccgcgcgcctc
ctgcgtgcgcctctggggctgctgcggctggaccccagcgggggcgcgctgctgctatgc
ggcctcgtagcgctgctgggctggagctggctgcggaggcgccgggcgcggggcatcccg
cccgggcccacgccctggcctctggtgggcaacttcggtcacgtgctgctgcctcccttc
ctccggcggcggagctggctgagcagcaggaccagggccgcagggattgatccctcggtc
ataggcccgcaggtgctcctggctcacctagcccgcgtgtacggcagcatcttcagcttc
tttatcggccactacctggtggtggtcctcagcgacttccacagcgtgcgcgaggcgctg
gtgcagcaggccgaggtcttcagcgaccgcccgcgggtgccgctcatctccatcgtgacc
aaggagaagggggttgtgtttgcacattatggtcccgtctggagacaacaaaggaagttc
tctcattcaactcttcgtcattttgggttgggaaaacttagcttggagcccaagattatt
gaggagttcaaatatgtgaaagcagaaatgcaaaagcacggagaagaccccttctgccct
ttctccatcatcagcaatgccgtctctaacatcatttgctccttgtgctttggccagcgc
tttgattacactaatagtgagttcaagaaaatgcttggttttatgtcacgaggcctagaa
atctgtctgaacagtcaagtcctcctggtcaacatatgcccttggctttattaccttccc
tttggaccatttaaggaattaagacaaattgaaaaggatataaccagtttccttaaaaaa
atcatcaaagaccatcaagagtctctggatagagagaaccctcaggacttcatagacatg
taccttctccacatggaagaggagaggaaaaataatagtaacagcagttttgatgaagag
tacttattttatatcattggggatctctttattgctgggactgataccacaactaactct
ttgctctggtgcctgctgtatatgtcgctgaaccccgatgtacaagaaaaggttcatgaa
gaaattgaaagagtcattggcgccaaccgagctccttccctcacagacaaggcccagatg
ccctacacagaagccaccatcatggaagtgcagaggctaactgtggtggtgccgcttgcc
attcctcatatgacctcagagaacacagtgctccaagggtataccattcctaaaggcaca
ttgatcttacccaacctgtggtcagtacatagagacccagccatttgggagaaaccggag
gatttctaccctaatcgatttctggatgaccaaggacaactaattaaaaaagaaaccttt
attccttttgggatagggaagcgggtgtgtatgggagaacaactggcaaagatggaatta
ttcctaatgtttgtgagcctaatgcagagtttcgcatttgctttacctgaggattctaag
aagcccctcctgactggaagatttggtctaactttagccccacatccatttaatataact
atttcaaggagatga

DBGET integrated database retrieval system