KEGG   Homo sapiens (human): 113675
Entry
113675            CDS       T01001                                 

Gene name
SDSL, SDH_2, SDS-RS1, TDH, cSDH
Definition
(RefSeq) serine dehydratase like
  KO
K17989  L-serine/L-threonine ammonia-lyase [EC:4.3.1.17 4.3.1.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00270  Cysteine and methionine metabolism
hsa00290  Valine, leucine and isoleucine biosynthesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    113675 (SDSL)
   00270 Cysteine and methionine metabolism
    113675 (SDSL)
   00290 Valine, leucine and isoleucine biosynthesis
    113675 (SDSL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     113675 (SDSL)
    4.3.1.19  threonine ammonia-lyase
     113675 (SDSL)
SSDB
Motif
Pfam: PALP Peripla_BP_6
Other DBs
NCBI-GeneID: 113675
NCBI-ProteinID: NP_001291922
HGNC: 30404
Ensembl: ENSG00000139410
Vega: OTTHUMG00000169551
Pharos: Q96GA7(Tbio)
UniProt: Q96GA7 A0A024RBL2
Structure
PDB: 
2RKB

Position
12q24.13
AA seq 329 aa
MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMA
KKGCRHLVCSSGGNAGIAAAYAARKLGIPATIVLPESTSLQVVQRLQGEGAEVQLTGKVW
DEANLRAQELAKRDGWENVPPFDHPLIWKGHASLVQELKAVLRTPPGALVLAVGGGGLLA
GVVAGLLEVGWQHVPIIAMETHGAHCFNAAITAGKLVTLPDITSVAKSLGAKTVAARALE
CMQVCKIHSEVVEDTEAVSAVQQLLDDERMLVEPACGAALAAIYSGLLRRLQAEGCLPPS
LTSVVVIVCGGNNINSRELQALKTHLGQV
NT seq 990 nt   +upstreamnt  +downstreamnt
atggacggccctgtggcagagcatgccaagcaggagccctttcacgtggtcacacctctg
ttggagagctgggcgctgtcccaggtggcgggcatgcctgtcttcctcaagtgtgagaat
gtgcagcccagcggctccttcaagattcggggcattgggcatttctgccaggagatggcc
aagaagggatgcagacacctggtgtgctcctcagggggtaatgcgggcatcgctgctgcc
tatgctgctaggaagctgggcattcctgccaccatcgtgctccccgagagcacctccctg
caggtggtgcagaggctgcagggggagggggccgaggttcagctgactggaaaggtctgg
gacgaggccaatctgagggcgcaagagttggccaagagggacggctgggagaatgtcccc
ccgtttgaccaccccctaatatggaaaggccacgccagcctggtgcaggagctgaaagca
gtgctgaggaccccaccaggtgccctggtgctggcagttgggggtgggggtctcctggcc
ggggtggtggctggcctgctggaggtgggctggcagcatgtacccatcattgccatggag
acccatggggcacactgcttcaatgcggccatcacagccggcaagctggtcacacttcca
gacatcaccagtgtggccaagagcctgggtgccaagacggtggccgctcgggccctggag
tgcatgcaggtgtgcaagattcactctgaagtggtggaggacaccgaggctgtgagcgct
gtgcagcagctcctggatgatgagcgtatgctggtggagcctgcctgtggggcagcctta
gcagccatctactcaggcctcctgcggaggctccaggccgagggctgcctgcccccttcc
ctgacttcagttgtggtaatcgtgtgtggaggcaacaacatcaacagccgagagctgcag
gctttgaaaacccacctgggccaggtctga

DBGET integrated database retrieval system