KEGG   Homo sapiens (human): 1137Help
Entry
1137              CDS       T01001                                 

Gene name
CHRNA4, BFNC, EBN, EBN1, NACHR, NACHRA4, NACRA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Disease
H00807  Autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE)
Drug target
Acetylcholine (DG01133): D00999
Altinicline maleate: D02839
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282 D08669
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1137 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1137 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    1137 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1137 (CHRNA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1137 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Blt1
Motif
Other DBs
NCBI-GeneID: 1137
NCBI-ProteinID: NP_000735
OMIM: 118504
HGNC: 1958
Ensembl: ENSG00000101204
Vega: OTTHUMG00000033080
Pharos: P43681(Tclin)
UniProt: P43681 Q59FV0 B4DK78
Structure
PDB: 

Position
20q13.33
AA seq 627 aa AA seqDB search
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR
PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG
GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV
SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggagctagggggccccggagcgccgcggctgctgccgccgctgctgctgcttctgggg
accggcctcctgcgcgccagcagccatgtggagacccgggcccacgccgaggagcggctc
ctgaagaaactcttctccggttacaacaagtggtcccgacccgtggccaacatctcggac
gtggtcctcgtccgcttcggcctgtccatcgctcagctcattgacgtggatgagaagaac
cagatgatgaccacgaacgtatgggtgaagcaggagtggcacgactacaagctgcgctgg
gacccagctgactatgagaatgtcacctccatccgcatcccctccgagctcatctggcgg
ccggacatcgtcctctacaacaatgctgacggggacttcgcggtcacccacctgaccaag
gcccacctgttccatgacgggcgggtgcagtggactcccccggccatttacaagagctcc
tgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaaattcggc
tcctggacctacgacaaggccaagatcgacctggtgaacatgcacagccgcgtggaccag
ctggacttctgggagagtggcgagtgggtcatcgtggatgccgtgggcacctacaacacc
aggaagtacgagtgctgtgccgagatctacccggacatcacctatgccttcgtcatccgg
cggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgctggtcttctacctgccctccgagtgtggcgagaagatcacgctgtgcatctcc
gtgctgctgtcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacctca
ctggtcatcccactcatcggcgagtacctgctgttcaccatgatcttcgtcaccctgtcc
atcgtcatcacggtcttcgtgctcaacgtgcaccaccgctcgccacgcacgcacaccatg
cccacctgggtacgcagggtcttcctggacatcgtgccacgcctgctcctcatgaagcgg
ccgtccgtggtcaaggacaattgccggcggctcatcgagtccatgcataagatggccagt
gccccgcgcttctggcccgagccagaaggggagccccctgccacgagcggcacccagagc
ctgcacccgccctcaccgtccttctgtgtccccctggatgtgccggctgagcctgggcct
tcctgcaagtcaccctccgaccagctccctcctcagcagcccctggaagctgagaaagcc
agcccccacccctcgcctggaccctgccgcccgccccacggcacccaggcaccagggctg
gccaaagccaggtccctcagcgtccagcacatgtccagccctggcgaagcggtggaaggc
ggcgtccggtgccggtctcggagcatccagtactgtgttccccgagacgatgccgccccc
gaggcagatggccaggctgccggcgccctggcctctcgcaacacccactcggctgagctc
ccacccccagaccagccctctccgtgcaaatgcacatgcaagaaggagccctcttcggtg
tccccgagcgccacggtcaagacccgcagcaccaaagcgccgcccccgcacctgcccctg
tcgccggccctgacccgggcggtggagggcgtccagtacattgcagaccacctgaaggcc
gaagacacagacttctcggtgaaggaggactggaagtacgtggccatggtcatcgaccgc
atcttcctctggatgttcatcatcgtctgcctgctggggacggtgggcctcttcctgccg
ccctggctggctggcatgatctag

DBGET integrated database retrieval system