KEGG   Homo sapiens (human): 1138Help
Entry
1138              CDS       T01001                                 

Gene name
CHRNA5, LNCR2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 5 subunit
  KO
K04807  nicotinic acetylcholine receptor alpha-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1138 (CHRNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1138 (CHRNA5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1138 (CHRNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 1138
NCBI-ProteinID: NP_000736
OMIM: 118505
HGNC: 1959
Ensembl: ENSG00000169684
Vega: OTTHUMG00000143858
Pharos: P30532(Tbio)
UniProt: P30532 Q6EWN4
Position
15q25.1
AA seq 468 aa AA seqDB search
MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYER
WVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKV
IRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTL
PKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgggggtcagggccccgcgcgctccgcctgctgctcttggtccagctggtc
gcggggcgctgcggtctagcgggcgcggcgggcggcgcgcagagaggattatctgaacct
tcttctattgcaaaacatgaagatagtttgcttaaggatttatttcaagactacgaaaga
tgggttcgtcctgtggaacacctgaatgacaaaataaaaataaaatttggacttgcaata
tctcaattggtggatgtggatgagaaaaatcagttaatgacaacaaacgtctggttgaaa
caggaatggatagatgtaaaattaagatggaaccctgatgactatggtggaataaaagtt
atacgtgttccttcagactctgtctggacaccagacatcgttttgtttgataatgcagat
ggacgttttgaagggaccagtacgaaaacagtcatcaggtacaatggcactgtcacctgg
actccaccggcaaactacaaaagttcctgtaccatagatgtcacgtttttcccatttgac
cttcagaactgttccatgaaatttggttcttggacttatgatggatcacaggttgatata
attctagaggaccaagatgtagacaagagagatttttttgataatggagaatgggagatt
gtgagtgcaacagggagcaaaggaaacagaaccgacagctgttgctggtatccgtatgtc
acttactcatttgtaatcaagcgcctgcctctcttttataccttgttccttataataccc
tgtattgggctctcatttttaactgtacttgtcttctatcttccttcaaatgaaggtgaa
aagatttgtctctgcacttcagtacttgtgtctttgactgtcttccttctggttattgaa
gagatcataccatcatcttcaaaagtcatacctctaattggagagtatctggtatttacc
atgatttttgtgacactgtcaattatggtaaccgtcttcgctatcaacattcatcatcgt
tcttcctcaacacataatgccatggcgcctttggtccgcaagatatttcttcacacgctt
cccaaactgctttgcatgagaagtcatgtagacaggtacttcactcagaaagaggaaact
gagagtggtagtggaccaaaatcttctagaaacacattggaagctgcgctcgattctatt
cgctacattacaagacacatcatgaaggaaaatgatgtccgtgaggttgttgaagattgg
aaattcatagcccaggttcttgatcggatgtttctgtggacttttcttttcgtttcaatt
gttggatctcttgggctttttgttcctgttatttataaatgggcaaatatattaatacca
gttcatattggaaatgcaaataagtga

DBGET integrated database retrieval system