KEGG   Homo sapiens (human): 113829
Entry
113829            CDS       T01001                                 
Symbol
SLC35A4
Name
(RefSeq) solute carrier family 35 member A4
  KO
K15273  solute carrier family 35 (probable UDP-sugar transporter), member A4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    113829 (SLC35A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   113829 (SLC35A4)
SSDB
Motif
Pfam: Nuc_sug_transp EamA
Other DBs
NCBI-GeneID: 113829
NCBI-ProteinID: NP_542401
HGNC: 20753
Ensembl: ENSG00000176087
Pharos: Q96G79(Tdark)
UniProt: Q96G79
Position
5:140564828..140569100
AA seq 324 aa
MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELT
KLLLCAFSLLVGWQAWPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSN
LKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPM
PLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGG
SGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRL
QLTAAFFLATLLIGLAMRLYYGSR
NT seq 975 nt   +upstreamnt  +downstreamnt
atgagtgtagaggatgggggtatgccaggcctgggccgtcccaggcaggcccgctggacc
ctgatgctactcctatccactgccatgtacggtgcccatgccccattgctggcactgtgc
catgtggacggccgagtgcccttccggccctcctcagccgtgctgctgactgagctgacc
aagctactgttatgcgccttctcccttctggtaggctggcaagcatggccccaggggccc
ccaccctggcgccaggctgctcccttcgcactatcagccctgctctatggcgctaacaac
aacctggtgatctatcttcagcgttacatggaccccagcacctaccaggtgctgagtaat
ctcaagattggaagcacagctgtgctctactgcctctgcctccggcaccgcctctctgtg
cgtcaggggttagcgctgctgctgctgatggctgcgggagcctgctatgcagcagggggc
cttcaagttcccgggaacacccttcccagtccccctccagcagctgctgccagccccatg
cccctgcatatcactccgctaggcctgctgctcctcattctgtactgcctcatctcaggc
ttgtcgtcagtgtacacagagctgctcatgaagcgacagcggctgcccctggcacttcag
aacctcttcctctacacttttggtgtgcttctgaatctaggtctgcatgctggcggcggc
tctggcccaggcctcctggaaggtttctcaggatgggcagcactcgtggtgctgagccag
gcactaaatggactgctcatgtctgctgtcatgaagcatggcagcagcatcacacgcctc
tttgtggtgtcctgctcgctggtggtcaacgccgtgctctcagcagtcctgctacggctg
cagctcacagccgccttcttcctggccacattgctcattggcctggccatgcgcctgtac
tatggcagccgctag

DBGET integrated database retrieval system