KEGG   Homo sapiens (human): 1139Help
Entry
1139              CDS       T01001                                 

Gene name
CHRNA7, CHRNA7-2, NACHRA7
Definition
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
hsa05204  Chemical carcinogenesis
Disease
H01877  Chromosome 15q13.3 microdeletion syndrome
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Bradanicline (DG01849): D10613 D10693
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Encenicline (DG01852): D10626 D10702 D10789
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1139 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1139 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1139 (CHRNA7)
 09160 Human Diseases
  09161 Cancers
   05204 Chemical carcinogenesis
    1139 (CHRNA7)
  09164 Substance dependence
   05033 Nicotine addiction
    1139 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1139 (CHRNA7)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1139 (CHRNA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Motif
Other DBs
NCBI-GeneID: 1139
NCBI-ProteinID: NP_000737
OMIM: 118511
HGNC: 1960
Ensembl: ENSG00000175344
Vega: OTTHUMG00000129285
UniProt: P36544
Structure
PDB: 

Position
15q13.3
AA seq 502 aa AA seqDB search
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgctcgccgggaggcgtctggctggcgctggccgcgtcgctcctgcacgtgtcc
ctgcaaggcgagttccagaggaagctttacaaggagctggtcaagaactacaatcccttg
gagaggcccgtggccaatgactcgcaaccactcaccgtctacttctccctgagcctcctg
cagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatg
tcttggacagatcactatttacagtggaatgtgtcagaatatccaggggtgaagactgtt
cgtttcccagatggccagatttggaaaccagacattcttctctataacagtgctgatgag
cgctttgacgccacattccacactaacgtgttggtgaattcttctgggcattgccagtac
ctgcctccaggcatattcaagagttcctgctacatcgatgtacgctggtttccctttgat
gtgcagcactgcaaactgaagtttgggtcctggtcttacggaggctggtccttggatctg
cagatgcaggaggcagatatcagtggctatatccccaatggagaatgggacctagtggga
atccccggcaagaggagtgaaaggttctatgagtgctgcaaagagccctaccccgatgtc
accttcacagtgaccatgcgccgcaggacgctctactatggcctcaacctgctgatcccc
tgtgtgctcatctccgccctcgccctgctggtgttcctgcttcctgcagattccggggag
aagatttccctggggataacagtcttactctctcttaccgtcttcatgctgctcgtggct
gagatcatgcccgcaacatccgattcggtaccattgatagcccagtacttcgccagcacc
atgatcatcgtgggcctctcggtggtggtgacagtgatcgtgctgcagtaccaccaccac
gaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcg
tggttcctgcgaatgaagaggcccggggaggacaaggtgcgcccggcctgccagcacaag
cagcggcgctgcagcctggccagtgtggagatgagcgccgtggcgccgccgcccgccagc
aacgggaacctgctgtacatcggcttccgcggcctggacggcgtgcactgtgtcccgacc
cccgactctggggtagtgtgtggccgcatggcctgctcccccacgcacgatgagcacctc
ctgcacggcgggcaaccccccgagggggacccggacttggccaagatcctggaggaggtc
cgctacattgccaaccgcttccgctgccaggacgaaagcgaggcggtctgcagcgagtgg
aagttcgccgcctgtgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc
atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagac
tttgcgtaa

DBGET integrated database retrieval system