KEGG   Homo sapiens (human): 1139Help
Entry
1139              CDS       T01001                                 

Gene name
CHRNA7, CHRNA7-2, NACHRA7
Definition
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
hsa05204  Chemical carcinogenesis
Disease
H01877  Chromosome 15q13.3 microdeletion syndrome
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Bradanicline (DG01849): D10613 D10693
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Encenicline (DG01852): D10626 D10702 D10789
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1139 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1139 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1139 (CHRNA7)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    1139 (CHRNA7)
  09165 Substance dependence
   05033 Nicotine addiction
    1139 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1139 (CHRNA7)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1139 (CHRNA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Motif
Other DBs
NCBI-GeneID: 1139
NCBI-ProteinID: NP_000737
OMIM: 118511
HGNC: 1960
Ensembl: ENSG00000175344
Vega: OTTHUMG00000129285
UniProt: P36544
Structure
PDB: 

Position
15q13.3
AA seq 502 aa AA seqDB search
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgctcgccgggaggcgtctggctggcgctggccgcgtcgctcctgcacgtgtcc
ctgcaaggcgagttccagaggaagctttacaaggagctggtcaagaactacaatcccttg
gagaggcccgtggccaatgactcgcaaccactcaccgtctacttctccctgagcctcctg
cagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatg
tcttggacagatcactatttacagtggaatgtgtcagaatatccaggggtgaagactgtt
cgtttcccagatggccagatttggaaaccagacattcttctctataacagtgctgatgag
cgctttgacgccacattccacactaacgtgttggtgaattcttctgggcattgccagtac
ctgcctccaggcatattcaagagttcctgctacatcgatgtacgctggtttccctttgat
gtgcagcactgcaaactgaagtttgggtcctggtcttacggaggctggtccttggatctg
cagatgcaggaggcagatatcagtggctatatccccaatggagaatgggacctagtggga
atccccggcaagaggagtgaaaggttctatgagtgctgcaaagagccctaccccgatgtc
accttcacagtgaccatgcgccgcaggacgctctactatggcctcaacctgctgatcccc
tgtgtgctcatctccgccctcgccctgctggtgttcctgcttcctgcagattccggggag
aagatttccctggggataacagtcttactctctcttaccgtcttcatgctgctcgtggct
gagatcatgcccgcaacatccgattcggtaccattgatagcccagtacttcgccagcacc
atgatcatcgtgggcctctcggtggtggtgacagtgatcgtgctgcagtaccaccaccac
gaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcg
tggttcctgcgaatgaagaggcccggggaggacaaggtgcgcccggcctgccagcacaag
cagcggcgctgcagcctggccagtgtggagatgagcgccgtggcgccgccgcccgccagc
aacgggaacctgctgtacatcggcttccgcggcctggacggcgtgcactgtgtcccgacc
cccgactctggggtagtgtgtggccgcatggcctgctcccccacgcacgatgagcacctc
ctgcacggcgggcaaccccccgagggggacccggacttggccaagatcctggaggaggtc
cgctacattgccaaccgcttccgctgccaggacgaaagcgaggcggtctgcagcgagtgg
aagttcgccgcctgtgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc
atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagac
tttgcgtaa

DBGET integrated database retrieval system