KEGG   Homo sapiens (human): 114026Help
Entry
114026            CDS       T01001                                 

Gene name
ZIM3, ZNF264, ZNF657
Definition
(RefSeq) zinc finger imprinted 3
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    114026 (ZIM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    114026 (ZIM3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    114026 (ZIM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 zinc_ribbon_15 C1_4 DUF3268 zf-met zf-C2HC_2 zf-C2H2_jaz XPA_N
Motif
Other DBs
NCBI-GeneID: 114026
NCBI-ProteinID: NP_443114
HGNC: 16366
Ensembl: ENSG00000141946
Vega: OTTHUMG00000183102
Pharos: Q96PE6(Tdark)
UniProt: Q96PE6
Position
19q13.43
AA seq 472 aa AA seqDB search
MNNSQGRVTFEDVTVNFTQGEWQRLNPEQRNLYRDVMLENYSNLVSVGQGETTKPDVILR
LEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVEC
DGSKKILPLGIDDVSSLQHYVQNNSHDDNGYRKLVGNNPSKFVGQQLKCNACRKLFSSKS
RLQSHLRRHACQKPFECHSCGRAFGEKWKLDKHQKTHAEERPYKCENCGNAYKQKSNLFQ
HQKMHTKEKPYQCKTCGKAFSWKSSCINHEKIHNAKKSYQCNECEKSFRQNSTLIQHKKV
HTGQKPFQCTDCGKAFIYKSDLVKHQRIHTGEKPYKCSICEKAFSQKSNVIDHEKIHTGK
RAYECDLCGNTFIQKKNLIQHKKIHTGEKPYECNRCGKAFFQKSNLHSHQKTHSGERTYR
CSECGKTFIRKLNLSLHKKTHTGQKPYGCSECGKAFADRSYLVRHQKRIHSR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattcccagggaagagtgaccttcgaggatgtcactgtgaacttcacccagggg
gagtggcagcggctgaatcccgaacagagaaacttgtacagggatgtgatgctggagaat
tacagcaaccttgtctctgtgggacaaggggaaaccaccaaacccgatgtgatcttgagg
ttggaacaaggaaaggagccatggttggaggaagaggaagtgctgggaagtggccgtgca
gaaaaaaatggggacattggagggcagatttggaagccaaaggatgtgaaagagagtctc
gcaagagaagtcccatcaatcaataaggaaacgctgactacgcagaaaggtgtagaatgt
gacggatctaagaaaatacttccactgggcatagatgatgtatcttccttgcaacactat
gtacaaaataattctcacgatgataatggatacagaaaattagttggcaataatccatcc
aaatttgtaggacaacaactgaaatgtaatgcctgtagaaagttattcagttcaaagtca
cgccttcaaagtcacctgaggaggcatgcctgtcaaaaaccctttgaatgtcatagctgt
ggaagagcattcggggagaagtggaagcttgataaacatcagaaaactcacgcagaggaa
aggccctataaatgtgagaactgtggaaatgcctacaagcagaagtcaaatctctttcaa
catcagaaaatgcatactaaagagaaaccctatcagtgtaagacatgtggaaaagccttt
tcctggaaatcatcctgcattaatcatgagaaaattcataatgccaagaaatcctatcag
tgtaatgaatgtgagaaatccttcaggcagaactcaaccctcattcaacataaaaaagtt
cacactggacaaaaaccctttcaatgtacggactgtggaaaggctttcatttacaagtca
gatcttgtgaaacaccagagaatacacacgggagagaaaccctataaatgtagcatatgt
gagaaggccttttcccagaaatccaatgtcatcgatcatgagaaaattcacactgggaag
agagcttatgagtgtgatctatgtggaaatacctttatccagaagaaaaacctcattcaa
cataaaaaaatccatactggggaaaagccctatgaatgtaacagatgtggaaaagccttc
tttcagaagtcaaaccttcatagccatcagaaaactcatagcggagagaggacctataga
tgtagtgaatgtggaaaaaccttcatccggaaattaaaccttagtttgcataaaaaaacc
catactggacaaaaaccttatggatgttctgaatgcggtaaagccttcgctgacaggtca
taccttgttaggcaccagaaaagaattcactccagatag

DBGET integrated database retrieval system