KEGG   Homo sapiens (human): 114088Help
Entry
114088            CDS       T01001                                 

Gene name
TRIM9, RNF91, SPRING
Definition
(RefSeq) tripartite motif containing 9
  KO
K10649  tripartite motif-containing protein 9/67
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114088 (TRIM9)
   04121 Ubiquitin system [BR:hsa04121]
    114088 (TRIM9)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    114088 (TRIM9)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    114088 (TRIM9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY fn3 zf-B_box zf-C3HC4_3 zf-C3HC4 zf-RING_UBOX zf-C3HC4_4 PRY zf-RING_5 CEBP_ZZ zf-RING_2 DUF2203
Motif
Other DBs
NCBI-GeneID: 114088
NCBI-ProteinID: NP_055978
OMIM: 606555
HGNC: 16288
Ensembl: ENSG00000100505
Vega: OTTHUMG00000140291
Pharos: Q9C026(Tbio)
UniProt: Q9C026
Structure
PDB: 

Position
14q22.1
AA seq 710 aa AA seqDB search
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAF
DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVAR
MDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTF
FINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggaggagatggaagaggagttgaaatgccccgtgtgcggctccttctatcgggagccc
atcatcctgccctgctctcacaatttgtgtcaggcgtgcgcccgcaacatcctggtgcag
accccagagtctgaatccccccagagccatcgggccgcgggctccggggtctccgactat
gactatctggacctggacaagatgagcctatacagcgaggcggacagcggctatggctcc
tacggggggttcgccagcgcccccactaccccgtgccagaagtcccccaacggcgtccgc
gtgtttcccccggctatgccgccaccggccacccacttgtcaccggccctggccccggtg
ccccgcaactcctgtatcacctgcccccagtgtcaccgcagcctcatcctggatgaccgg
gggctccgcggcttccccaagaatcgcgtactggaaggggtaattgaccgctaccagcag
agcaaagccgcggccctcaagtgccagctctgcgagaaggcgcccaaggaagccaccgtc
atgtgcgaacagtgcgatgtcttctactgcgatccgtgccgcctgcgctgccacccgccc
cgggggcccctagccaagcaccgcctggtgcccccggcccagggtcgtgtgagccggagg
ctgagcccacgcaaggtctccacctgcacagaccacgagctggagaaccacagcatgtac
tgcgtgcaatgcaagatgcccgtgtgctaccagtgcttggaggagggcaaacactccagc
cacgaagtcaaggctctgggggccatgtggaaactacataagagccagctctcccaggcg
ctgaacggactgtcagacagggccaaagaagccaaggagtttctggtacagctgcgcaac
atggtccagcagatccaggagaacagtgtggagtttgaagcctgtctggtggcccaatgt
gatgccctcatcgatgccctcaacagaagaaaagcccagctgctggcccgcgtcaacaag
gagcatgagcacaagctgaaggtggttcgagatcagatctctcactgcacagtgaaattg
cgccagaccacaggtctcatggagtactgcttggaggtgattaaggaaaatgatcctagt
ggttttttgcagatttctgacgccctcataagaagagtgcacctgactgaggatcagtgg
ggtaaaggcacactcactccaaggatgaccacggactttgacttgagtctggacaacagc
cctctgctgcaatccatccaccagctggatttcgtgcaagtgaaagcttcctctccagtc
ccagcaacccctatcctacagctggaggaatgttgtacccacaacaacagcgctacgttg
tcctggaaacagccacctctgtccacggtgcccgccgatggatacattctggagctggat
gatggcaacggtggtcaattccgggaggtgtatgtggggaaggagacaatgtgcactgtg
gatggtcttcacttcaacagcacatacaacgctcgggtcaaggccttcaacaaaacagga
gtcagcccgtacagcaagaccctggtcctccaaacgtctgaggtggcctggtttgctttc
gaccctggctcggcgcactcggacatcatcctctccaatgacaacctgacagtgacctgt
agtagctatgatgaccgggtggtgctagggaagactggcttctccaagggcatccactac
tgggagctcacggtagatcgctatgacaaccaccctgatcctgcctttggtgtggctcgc
atggacgtgatgaaggatgtgatgttaggaaaagacgacaaagcttgggcaatgtatgtg
gacaataaccggagctggttcatgcacaacaactcgcacaccaacagaactgagggaggg
atcacaaaaggggccacaattggggtcctcctcgacttaaatagaaaaaacttgacattt
tttatcaacgatgaacaacaaggtcccatagcatttgataacgtggagggcctcttcttc
cctgcggtcagcctgaacaggaacgtgcaggtcacgctgcacaccgggctcccagtcccc
gacttctactccagcagagcatcaatagcctaa

DBGET integrated database retrieval system