KEGG   Homo sapiens (human): 1141Help
Entry
1141              CDS       T01001                                 

Gene name
CHRNB2, EFNL3, nAChRB2
Definition
(RefSeq) cholinergic receptor nicotinic beta 2 subunit
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Disease
H00807  Autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE)
Drug target
Acetylcholine (DG01133): D00999
Altinicline maleate: D02839
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282 D08669
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1141 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1141 (CHRNB2)
 09160 Human Diseases
  09164 Substance dependence
   05033 Nicotine addiction
    1141 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1141 (CHRNB2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1141 (CHRNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 1141
NCBI-ProteinID: NP_000739
OMIM: 118507
HGNC: 1962
Ensembl: ENSG00000160716
Vega: OTTHUMG00000037262
Pharos: P17787(Tclin)
UniProt: P17787 Q5SXY3
Structure
PDB: 

Position
1q21.3
AA seq 502 aa AA seqDB search
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcgctgcggccccgtggcgctgctccttggcttcggcctcctccggctgtgc
tcaggggtgtggggtacggatacagaggagcggctggtggagcatctcctggatccttcc
cgctacaacaagcttatccgcccagccaccaatggctctgagctggtgacagtacagctt
atggtgtcactggcccagctcatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtctggctgacccaggagtgggaagattatcgcctcacctggaagcctgaagagtttgac
aacatgaagaaagttcggctcccttccaaacacatctggctcccagatgtggtcctgtac
aacaatgctgacggcatgtacgaggtgtccttctattccaatgccgtggtctcctatgat
ggcagcatcttctggctgccgcctgccatctacaagagcgcatgcaagattgaagtaaag
cacttcccatttgaccagcagaactgcaccatgaagttccgttcgtggacctacgaccgc
acagagatcgacttggtgctgaagagtgaggtggccagcctggacgacttcacacctagt
ggtgagtgggacatcgtggcgctgccgggccggcgcaacgagaaccccgacgactctacg
tacgtggacatcacgtatgacttcatcattcgccgcaagccgctcttctacaccatcaac
ctcatcatcccctgtgtgctcatcacctcgctagccatccttgtcttctacctgccatcc
gactgtggcgagaagatgacgttgtgcatctcagtgctgctggcgctcacggtcttcctg
ctgctcatctccaagatcgtgcctcccacctccctcgacgtgccgctcgtcggcaagtac
ctcatgttcaccatggtgcttgtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcgcccaccacgcacaccatggcgccctgggtgaaggtcgtcttcctg
gagaagctgcccgcgctgctcttcatgcagcagccacgccatcattgcgcccgtcagcgc
ctgcgcctgcggcgacgccagcgtgagcgcgagggcgctggagccctcttcttccgcgaa
gccccaggggccgactcctgcacgtgcttcgtcaaccgcgcgtcggtgcaggggttggcc
ggggccttcggggctgagcctgcaccagtggcgggccccgggcgctcaggggagccgtgt
ggctgtggcctccgggaggcggtggacggcgtgcgcttcatcgcagaccacatgcggagc
gaggacgatgaccagagcgtgagtgaggactggaagtacgtcgccatggtgatcgaccgc
ctcttcctctggatctttgtctttgtctgtgtctttggcaccatcggcatgttcctgcag
cctctcttccagaactacaccaccaccaccttcctccactcagaccactcagcccccagc
tccaagtga

DBGET integrated database retrieval system