KEGG   Homo sapiens (human): 114134
Entry
114134            CDS       T01001                                 
Symbol
SLC2A13, HMIT
Name
(RefSeq) solute carrier family 2 member 13
  KO
K08150  MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    114134 (SLC2A13)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   114134 (SLC2A13)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    114134 (SLC2A13)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 Mpt_N PSI_integrin PSI
Other DBs
NCBI-GeneID: 114134
NCBI-ProteinID: NP_443117
OMIM: 611036
HGNC: 15956
Ensembl: ENSG00000151229
Vega: OTTHUMG00000059743
Pharos: Q96QE2(Tbio)
UniProt: Q96QE2
Position
12:complement(39755025..40106081)
AA seq 648 aa
MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGG
VGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQ
ELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLV
VGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRY
MLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIE
EEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDD
RLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAW
GRCENETKFKTEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWA
RSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGK
KLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgtcccgcaaggcaagcgagaatgtggagtacacgctgcggagcctgagcagcctgatg
ggcgagcggcgcaggaagcagccggagccggacgcggcgagcgcggccggggagtgcagc
ctcctggctgccgccgaatcgagcaccagcctgcagagcgcgggcgcgggcggcggcggc
gtcggggacctggagcgcgcggcgcggcggcagttccagcaggacgagacccccgccttc
gtgtacgtggtggccgtcttctccgcgctgggcggcttcctgtttggctatgacaccggg
gtggtgtcaggggccatgctgctgctcaagcggcagctcagtctggacgcgctgtggcag
gagctgctggtgtccagcacggtgggggcggctgccgtctcggcgctggccggaggcgcc
ctcaacggcgtcttcggccgccgcgctgccatcctcctggccagtgccctcttcaccgcc
ggctccgcggtgctggctgcggccaacaacaaggagacactgctcgccggccgcctggtc
gtgggactcggcatcggcattgcttctatgacagtgccagtgtacattgcggaggtctca
ccacccaatttaagaggccgattagtcaccattaataccctcttcatcacaggagggcag
ttctttgcaagtgttgttgatggagccttcagttatctccagaaggatggatggaggtac
atgttgggacttgcagcagttccggcggttatacagttttttggctttctctttttgcct
gaaagccctcgatggcttattcagaaaggacagactcagaaggcccgtagaattttatct
cagatgcgtggtaaccagaccattgatgaggaatatgatagcatcaaaaacaacattgaa
gaggaggaaaaagaggttggctcagctggacctgtgatctgcagaatgctgagttatccc
ccaactcgccgagctttaattgtgggttgtggcctacaaatgttccagcagctctcaggc
attaacaccatcatgtactacagtgcaaccattctgcagatgtctggtgttgaagatgat
agacttgcaatatggctggcttcagttacagccttcacaaatttcattttcacacttgtg
ggagtctggcttgttgagaaggtgggccgcagaaagcttacctttggtagtttagcaggt
accaccgtagcactcattattcttgccttgggatttgtgctatcagcccaagtttcccca
cgcatcacttttaagccaatagctccgtcaggtcagaacgccacttgcacaagatacagt
tactgtaatgaatgtatgttggatccagactgcggtttctgctacaagatgaacaaatca
actgtcattgactcctcctgtgttccagttaataaagcatctacaaatgaggcagcctgg
ggcaggtgtgaaaatgaaaccaagttcaaaacagaagatatattttgggcttacaatttc
tgccctactccatactcctggactgcacttctgggccttattttatatcttgtcttcttt
gcacctggaatgggaccaatgccttggactgtgaattctgaaatatatcccctttgggca
agaagtacaggaaatgcatgttcatctggaataaactggattttcaatgtcctggtttca
ctaacatttttacacacagcagagtatcttacatactatggagctttcttcctctatgct
ggatttgctgctgtgggactccttttcatctatggctgtcttcctgagaccaaaggcaaa
aaattagaggaaattgaatcactctttgacaacaggctatgtacatgtggcacttcagat
tctgatgaagggagatatattgaatatattcgggtaaagggaagtaactatcatctttct
gacaatgatgcttctgatgtggaataa

DBGET integrated database retrieval system