KEGG   Homo sapiens (human): 1143Help
Entry
1143              CDS       T01001                                 

Gene name
CHRNB4
Definition
(RefSeq) cholinergic receptor nicotinic beta 4 subunit
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1143 (CHRNB4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1143 (CHRNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1143 (CHRNB4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1143 (CHRNB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 1143
NCBI-ProteinID: NP_000741
OMIM: 118509
HGNC: 1964
Ensembl: ENSG00000117971
Vega: OTTHUMG00000143860
Pharos: P30926(Tclin)
UniProt: P30926
Position
15q25.1
AA seq 498 aa AA seqDB search
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcgcgccttccctggtccttttcttcctggtcgccctttgcgggcgcgggaac
tgccgcgtggccaatgcggaggaaaagctgatggacgaccttctgaacaaaacccgttac
aataacctgatccgcccagccaccagctcctcacagctcatctccatcaagctgcagctc
tccctggcccagcttatcagcgtgaatgagcgagagcagatcatgaccaccaatgtctgg
ctgaaacaggaatggactgattaccgcctgacctggaacagctcccgctacgagggtgtg
aacatcctgaggatccctgcaaagcgcatctggttgcctgacatcgtgctttacaacaac
gccgacgggacctatgaggtgtctgtctacaccaacttgatagtccggtccaacggcagc
gtcctgtggctgccccctgccatctacaagagcgcctgcaagattgaggtgaagtacttt
cccttcgaccagcagaactgcaccctcaagttccgctcctggacctatgaccacacggag
atagacatggtcctcatgacgcccacagccagcatggatgactttactcccagtggtgag
tgggacatagtggccctcccagggagaaggacagtgaacccacaagaccccagctacgtg
gacgtgacttacgacttcatcatcaagcgcaagcctctgttctacaccatcaacctcatc
atcccctgcgtgctcaccaccttgctggccatcctcgtcttctacctgccatccgactgc
ggcgagaagatgacactgtgcatctcagtgctgctggcactgacattcttcctgctgctc
atctccaagatcgtgccacccacctccctcgatgtgcctctcatcggcaagtacctcatg
ttcaccatggtgctggtcaccttctccatcgtcaccagcgtctgtgtgctcaatgtgcac
caccgctcgcccagcacccacaccatggcaccctgggtcaagcgctgcttcctgcacaag
ctgcctaccttcctcttcatgaagcgccctggccccgacagcagcccggccagagccttc
ccgcccagcaagtcatgcgtgaccaagcccgaggccaccgccacctccaccagcccctcc
aacttctatgggaactccatgtactttgtgaaccccgcctctgcagcttccaagtctcca
gccggctctaccccggtggctatccccagggatttctggctgcggtcctctgggaggttc
cgacaggatgtgcaggaggcattagaaggtgtcagcttcatcgcccagcacatgaagaat
gacgatgaagaccagagtgtcgttgaggactggaagtacgtggctatggtggtggaccgg
ctgttcctgtgggtgttcatgtttgtgtgcgtcctgggcactgtggggctcttcctaccg
cccctcttccagacccatgcagcttctgaggggccctacgctgcccagcgtgactga

DBGET integrated database retrieval system