KEGG   Homo sapiens (human): 1146
Entry
1146              CDS       T01001                                 

Gene name
CHRNG, ACHRG
Definition
(RefSeq) cholinergic receptor nicotinic gamma subunit
  KO
K04818  nicotinic acetylcholine receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Metocurine iodide: D00761
Nicotine (DG00994): D03365 D05156 D05157
Suxamethonium (DG00768): D00766 D02275
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1146 (CHRNG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1146 (CHRNG)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1146 (CHRNG)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 1146
NCBI-ProteinID: NP_005190
OMIM: 100730
HGNC: 1967
Ensembl: ENSG00000196811
Vega: OTTHUMG00000153327
Pharos: P07510(Tclin)
UniProt: P07510
Position
2q37.1
AA seq 517 aa
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLT
NLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDG
VFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDL
QLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
PLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQ
AVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVR
PLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGP
ELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAM
LSLFICGTAGIFLMAHYNRVPALPFPGDPRPYLPSPD
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgcatgggggccaggggccgctgctcctcctgctgctgctggctgtctgcctgggggcc
cagggccggaaccaggaggagcgcctgctcgcagacctgatgcaaaactacgaccccaac
ctgcggcccgcggaacgagactcggatgtggtcaatgtcagcctgaagctaaccctcacc
aacctcatctccctgaacgagcgagaggaagccctcaccaccaatgtctggatagagatg
cagtggtgcgactatcgcctgcgctgggatccgcgagactacgaaggcctgtgggtgctg
agggtgccgtccaccatggtgtggcggccggatatcgtgctggagaacaacgtggacggt
gtcttcgaggtggccctctactgcaatgtgctcgtgtcccctgacggctgtatctactgg
ctgccgcctgccatcttccgttccgcctgctctatctcagtcacctacttccccttcgac
tggcagaactgctcccttatcttccagtcccagacttacagcaccaatgagattgatctg
cagctgagtcaggaagatggccagaccatcgagtggattttcattgaccctgaggccttc
acagagaatggggagtgggccatccagcaccgaccagccaagatgctcctggacccagcg
gcgccagcccaggaagcaggccaccagaaggtggtgttctacctgctcatccagcgcaag
cccctcttctacgtcatcaacatcatcgccccctgtgtgctcatctcctctgtcgccatc
ctcatccacttccttcctgccaaggctgggggccagaagtgtaccgtcgccatcaacgtg
ctcctggcccagactgtcttcctcttccttgtggccaagaaggtgcctgaaacctcccag
gcggtgccactcatcagcaagtacctgaccttcctcctggtggtgaccatcctcattgtc
gtgaatgctgtggttgtgctcaatgtctccttgcggtctccacacacacactccatggcc
cgaggggtccgcaaggtgttcctgaggctcttgccccagctgctgaggatgcacgttcgc
ccgctggccccggcagctgtgcaggacacccagtcccggctacagaatggctcctcggga
tggtcgatcacaactggggaggaggtggccctctgcctgcctcgcagtgaactcctcttc
cagcagtggcagcggcaagggctggtggcggcagcgctggagaagctagagaaaggcccg
gagttagggctgagccagttctgtggcagcctgaagcaggctgccccagccatccaggcc
tgtgtggaagcctgcaacctcattgcctgtgcccggcaccagcagagtcactttgacaat
gggaatgaggagtggttcctggtgggccgagtgctggaccgcgtctgcttcctggccatg
ctctcgctcttcatctgtggcacagctggcatcttcctcatggcccactacaaccgggtg
ccggccctgccattccctggagatccacgcccctacctgccctcaccagactga

DBGET integrated database retrieval system