KEGG   Homo sapiens (human): 114609
Entry
114609            CDS       T01001                                 

Gene name
TIRAP, BACTS1, Mal, MyD88-2, wyatt
Definition
(RefSeq) TIR domain containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06263  Hepatocellular carcinoma
  Element
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114609 (TIRAP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114609 (TIRAP)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114609 (TIRAP)
  09172 Infectious disease: viral
   05161 Hepatitis B
    114609 (TIRAP)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    114609 (TIRAP)
   05132 Salmonella infection
    114609 (TIRAP)
   05133 Pertussis
    114609 (TIRAP)
   05152 Tuberculosis
    114609 (TIRAP)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114609 (TIRAP)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 114609
NCBI-ProteinID: NP_001034750
OMIM: 606252
HGNC: 17192
Ensembl: ENSG00000150455
Vega: OTTHUMG00000140373
Pharos: P58753(Tbio)
UniProt: P58753 A0A024R3M4
Structure
PDB: 

Position
11q24.2
AA seq 221 aa
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcatcatcgacctccctcccagctcctggctctcggcctaagaagcctctaggcaag
atggctgactggttcaggcagaccctgctgaagaagcccaagaagaggcccaactcccca
gaaagcacctccagcgatgcttcacagcctacctcacaggacagcccactacccccaagc
ctcagctcagtcacgtctcccagcctgccacccacacatgcgagtgacagtggcagtagt
cgctggagcaaagactatgacgtctgcgtgtgccacagtgaggaagacctggtggccgcc
caggacctggtctcctacttggaaggcagcactgccagcctgcgctgcttcctgcaactc
cgggatgcaaccccaggcggcgctatagtgtccgagctgtgccaggcactgagcagtagt
cactgccgggtgctgctcatcacgccgggcttccttcaggacccctggtgcaagtaccag
atgctgcaggccctgaccgaggctccaggggccgagggctgcaccatccccctgctgtcg
ggcctcagcagagctgcctacccacctgagctccgattcatgtactacgtcgatggcagg
ggccctgatggtggctttcgtcaagtcaaagaagctgtcatgcgttatctgcagacactc
agttga

DBGET integrated database retrieval system