KEGG   Homo sapiens (human): 1147Help
Entry
1147              CDS       T01001                                 

Gene name
CHUK, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04068  FoxO signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
Network
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00201  KSHV vFLIP to host-cell-protein activation
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00397  HCMV UL26 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
Disease
H00882  Cocoon syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1147 (CHUK)
   04010 MAPK signaling pathway
    1147 (CHUK)
   04064 NF-kappa B signaling pathway
    1147 (CHUK)
   04668 TNF signaling pathway
    1147 (CHUK)
   04068 FoxO signaling pathway
    1147 (CHUK)
   04151 PI3K-Akt signaling pathway
    1147 (CHUK)
   04150 mTOR signaling pathway
    1147 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1147 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    1147 (CHUK)
   04621 NOD-like receptor signaling pathway
    1147 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    1147 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    1147 (CHUK)
   04625 C-type lectin receptor signaling pathway
    1147 (CHUK)
   04660 T cell receptor signaling pathway
    1147 (CHUK)
   04658 Th1 and Th2 cell differentiation
    1147 (CHUK)
   04659 Th17 cell differentiation
    1147 (CHUK)
   04657 IL-17 signaling pathway
    1147 (CHUK)
   04662 B cell receptor signaling pathway
    1147 (CHUK)
   04062 Chemokine signaling pathway
    1147 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    1147 (CHUK)
  09158 Development
   04380 Osteoclast differentiation
    1147 (CHUK)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    1147 (CHUK)
   05212 Pancreatic cancer
    1147 (CHUK)
   05221 Acute myeloid leukemia
    1147 (CHUK)
   05220 Chronic myeloid leukemia
    1147 (CHUK)
   05215 Prostate cancer
    1147 (CHUK)
   05222 Small cell lung cancer
    1147 (CHUK)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1147 (CHUK)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1147 (CHUK)
   05131 Shigellosis
    1147 (CHUK)
   05166 HTLV-I infection
    1147 (CHUK)
   05162 Measles
    1147 (CHUK)
   05161 Hepatitis B
    1147 (CHUK)
   05160 Hepatitis C
    1147 (CHUK)
   05168 Herpes simplex infection
    1147 (CHUK)
   05163 Human cytomegalovirus infection
    1147 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1147 (CHUK)
   05169 Epstein-Barr virus infection
    1147 (CHUK)
   05165 Human papillomavirus infection
    1147 (CHUK)
   05145 Toxoplasmosis
    1147 (CHUK)
   05142 Chagas disease (American trypanosomiasis)
    1147 (CHUK)
  09168 Drug resistance
   01523 Antifolate resistance
    1147 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1147 (CHUK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     1147 (CHUK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   1147 (CHUK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr IKKbetaNEMObind Kdo AviRa
Motif
Other DBs
NCBI-GeneID: 1147
NCBI-ProteinID: NP_001269
OMIM: 600664
HGNC: 1974
Ensembl: ENSG00000213341
Vega: OTTHUMG00000018899
Pharos: O15111(Tchem)
UniProt: O15111
Structure
PDB: 

Position
10q24.31
AA seq 745 aa AA seqDB search
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatggtgccat
gaaatccagattatgaagaagttgaaccatgccaatgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttagtagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtattaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtatatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tatagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaatatcaaagaagctgacaatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacatca
gcatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
caagatggggagacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcaatagtatgatgaatcttgattgg
agttggttaacagaatga

KEGG   Homo sapiens (human): 3551Help
Entry
3551              CDS       T01001                                 

Gene name
IKBKB, IKK-beta, IKK2, IKKB, IMD15, NFKBIKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04068  FoxO signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
Network
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00201  KSHV vFLIP to host-cell-protein activation
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00397  HCMV UL26 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    3551 (IKBKB)
   04010 MAPK signaling pathway
    3551 (IKBKB)
   04064 NF-kappa B signaling pathway
    3551 (IKBKB)
   04668 TNF signaling pathway
    3551 (IKBKB)
   04068 FoxO signaling pathway
    3551 (IKBKB)
   04151 PI3K-Akt signaling pathway
    3551 (IKBKB)
   04150 mTOR signaling pathway
    3551 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    3551 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3551 (IKBKB)
   04621 NOD-like receptor signaling pathway
    3551 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    3551 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    3551 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    3551 (IKBKB)
   04660 T cell receptor signaling pathway
    3551 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    3551 (IKBKB)
   04659 Th17 cell differentiation
    3551 (IKBKB)
   04657 IL-17 signaling pathway
    3551 (IKBKB)
   04662 B cell receptor signaling pathway
    3551 (IKBKB)
   04062 Chemokine signaling pathway
    3551 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    3551 (IKBKB)
   04920 Adipocytokine signaling pathway
    3551 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3551 (IKBKB)
  09158 Development
   04380 Osteoclast differentiation
    3551 (IKBKB)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3551 (IKBKB)
   05206 MicroRNAs in cancer
    3551 (IKBKB)
   05212 Pancreatic cancer
    3551 (IKBKB)
   05221 Acute myeloid leukemia
    3551 (IKBKB)
   05220 Chronic myeloid leukemia
    3551 (IKBKB)
   05215 Prostate cancer
    3551 (IKBKB)
   05222 Small cell lung cancer
    3551 (IKBKB)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3551 (IKBKB)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3551 (IKBKB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3551 (IKBKB)
   04931 Insulin resistance
    3551 (IKBKB)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3551 (IKBKB)
   05131 Shigellosis
    3551 (IKBKB)
   05166 HTLV-I infection
    3551 (IKBKB)
   05164 Influenza A
    3551 (IKBKB)
   05161 Hepatitis B
    3551 (IKBKB)
   05160 Hepatitis C
    3551 (IKBKB)
   05168 Herpes simplex infection
    3551 (IKBKB)
   05163 Human cytomegalovirus infection
    3551 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3551 (IKBKB)
   05169 Epstein-Barr virus infection
    3551 (IKBKB)
   05165 Human papillomavirus infection
    3551 (IKBKB)
   05145 Toxoplasmosis
    3551 (IKBKB)
   05142 Chagas disease (American trypanosomiasis)
    3551 (IKBKB)
  09168 Drug resistance
   01523 Antifolate resistance
    3551 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3551 (IKBKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     3551 (IKBKB)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   3551 (IKBKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr IKKbetaNEMObind Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Motif
Other DBs
NCBI-GeneID: 3551
NCBI-ProteinID: NP_001547
OMIM: 603258
HGNC: 5960
Ensembl: ENSG00000104365
Vega: OTTHUMG00000164092
Pharos: O14920(Tchem)
UniProt: O14920
Structure
PDB: 

Position
8p11.21
AA seq 756 aa AA seqDB search
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLE
NAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacgcagacatgtggggcctgggaaatgaaagagcgc
cttgggacagggggatttggaaatgtcatccgatggcacaatcaggaaacaggtgagcag
attgccatcaagcagtgccggcaggagctcagcccccggaaccgagagcggtggtgcctg
gagatccagatcatgagaaggctgacccaccccaatgtggtggctgcccgagatgtccct
gaggggatgcagaacttggcgcccaatgacctgcccctgctggccatggagtactgccaa
ggaggagatctccggaagtacctgaaccagtttgagaactgctgtggtctgcgggaaggt
gccatcctcaccttgctgagtgacattgcctctgcgcttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgcaca
tcattcgtggggaccctgcagtacctggccccagagctactggagcagcagaagtacaca
gtgaccgtcgactactggagcttcggcaccctggcctttgagtgcatcacgggcttccgg
cccttcctccccaactggcagcccgtgcagtggcattcaaaagtgcggcagaagagtgag
gtggacattgttgttagcgaagacttgaatggaacggtgaagttttcaagctctttaccc
taccccaataatcttaacagtgtcctggctgagcgactggagaagtggctgcaactgatg
ctgatgtggcacccccgacagaggggcacggatcccacgtatgggcccaatggctgcttc
aaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacgggc
accatccacacctaccctgtgacagaggatgagagtctgcagagcttgaaggccagaatc
caacaggacacgggcatcccagaggaggaccaggagctgctgcaggaagcgggcctggcg
ttgatccccgataagcctgccactcagtgtatttcagacggcaagttaaatgagggccac
acattggacatggatcttgtttttctctttgacaacagtaaaatcacctatgagactcag
atctccccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaat
ctcgccttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaagattgcaaccggctgcagcagggacagcgagccgccatgatgaatctcctccga
aacaacagctgcctctccaaaatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacagcgagcaa
accgagtttgggatcacatcagataaactgctgctggcctggagggaaatggagcaggct
gtggagctctgtgggcgggagaacgaagtgaaactcctggtagaacggatgatggctctg
cagaccgacattgtggacttacagaggagccccatgggccggaagcaggggggaacgctg
gacgacctagaggagcaagcaagggagctgtacaggagactaagggaaaaacctcgagac
cagcgaactgagggtgacagtcaggaaatggtacggctgctgcttcaggcaattcagagc
ttcgagaagaaagtgcgagtgatctatacgcagctcagtaaaactgtggtttgcaagcag
aaggcgctggaactgttgcccaaggtggaagaggtggtgagcttaatgaatgaggatgag
aagactgttgtccggctgcaggagaagcggcagaaggagctctggaatctcctgaagatt
gcttgtagcaaggtccgtggtcctgtcagtggaagcccggatagcatgaatgcctctcga
cttagccagcctgggcagctgatgtctcagccctccacggcctccaacagcttacctgag
ccagccaagaagagtgaagaactggtggctgaagcacataacctctgcaccctgctagaa
aatgccatacaggacactgtgagggaacaagaccagagtttcacggccctagactggagc
tggttacagacggaagaagaagagcacagctgcctggagcaggcctcatga

KEGG   Homo sapiens (human): 8517Help
Entry
8517              CDS       T01001                                 

Gene name
IKBKG, AMCBX1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, ZC2HC9
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05340  Primary immunodeficiency
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
Network
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00201  KSHV vFLIP to host-cell-protein activation
N00221  HTLV-I Tax to host-cell-protein activation
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00397  HCMV UL26 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
Disease
H00095  Ectodermal dysplasia associated immunodeficiency (EDA-ID)
H00540  Osteoporosis, lymphedema, anhydrotic ectodermal dysplasia with immunodeficiency (OLEDAID)
H00645  Incontinentia pigmenti
H01245  Immunodeficiency without anhidrotic ectodermal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8517 (IKBKG)
   04010 MAPK signaling pathway
    8517 (IKBKG)
   04064 NF-kappa B signaling pathway
    8517 (IKBKG)
   04668 TNF signaling pathway
    8517 (IKBKG)
   04151 PI3K-Akt signaling pathway
    8517 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8517 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    8517 (IKBKG)
   04621 NOD-like receptor signaling pathway
    8517 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    8517 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    8517 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    8517 (IKBKG)
   04660 T cell receptor signaling pathway
    8517 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    8517 (IKBKG)
   04659 Th17 cell differentiation
    8517 (IKBKG)
   04657 IL-17 signaling pathway
    8517 (IKBKG)
   04662 B cell receptor signaling pathway
    8517 (IKBKG)
   04062 Chemokine signaling pathway
    8517 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    8517 (IKBKG)
  09158 Development
   04380 Osteoclast differentiation
    8517 (IKBKG)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    8517 (IKBKG)
   05203 Viral carcinogenesis
    8517 (IKBKG)
   05212 Pancreatic cancer
    8517 (IKBKG)
   05221 Acute myeloid leukemia
    8517 (IKBKG)
   05220 Chronic myeloid leukemia
    8517 (IKBKG)
   05215 Prostate cancer
    8517 (IKBKG)
   05222 Small cell lung cancer
    8517 (IKBKG)
  09162 Immune diseases
   05340 Primary immunodeficiency
    8517 (IKBKG)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    8517 (IKBKG)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    8517 (IKBKG)
   05131 Shigellosis
    8517 (IKBKG)
   05166 HTLV-I infection
    8517 (IKBKG)
   05161 Hepatitis B
    8517 (IKBKG)
   05160 Hepatitis C
    8517 (IKBKG)
   05168 Herpes simplex infection
    8517 (IKBKG)
   05163 Human cytomegalovirus infection
    8517 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    8517 (IKBKG)
   05169 Epstein-Barr virus infection
    8517 (IKBKG)
   05165 Human papillomavirus infection
    8517 (IKBKG)
   05145 Toxoplasmosis
    8517 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    8517 (IKBKG)
  09168 Drug resistance
   01523 Antifolate resistance
    8517 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8517 (IKBKG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   8517 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CC2-LZ NEMO Bacillus_HBL LLC1
Motif
Other DBs
NCBI-GeneID: 8517
NCBI-ProteinID: NP_001093327
OMIM: 300248
HGNC: 5961
Ensembl: ENSG00000269335
Vega: OTTHUMG00000024234
Pharos: Q9Y6K9(Tbio)
UniProt: Q9Y6K9
Structure
PDB: 

Position
Xq28
AA seq 419 aa AA seqDB search
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaataggcacctctggaagagccaactgtgtgagatggtgcagcccagtggtggcccg
gcagcagatcaggacgtactgggcgaagagtctcctctggggaagccagccatgctgcac
ctgccttcagaacagggcgctcctgagaccctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagattctgcgggagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcaagttccaggaggcc
aggaaactggtggagagactcggcctggagaagctcgatctgaagaggcagaaggagcag
gctctgcgggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacgtccttgctcggggagctgcaggagagccagagtcgcttg
gaggctgccactaaggaatgccaggctctggagggtcgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcgctccgcatggagcgccaggccgcc
tcggaggagaagaggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagcgtggtgggcagtgagcggaagcgaggaatgcagctg
gaagatctcaaacagcagctccagcaggccgaggaggccctggtggccaaacaggaggtg
atcgataagctgaaggaggaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggccgagaagaaggagctcctgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcggccaggatcgaggacatgaggaagcggcat
gtcgaggtctcccaggcccccttgccccccgcccctgcctacctctcctctcccctggcc
ctgcccagccagaggaggagcccccccgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system