KEGG   Homo sapiens (human): 114757
Entry
114757            CDS       T01001                                 
Symbol
CYGB, HGB, STAP
Name
(RefSeq) cytoglobin
  KO
K21894  cytoglobin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    114757 (CYGB)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   114757 (CYGB)
SSDB
Motif
Pfam: Globin YfcL
Other DBs
NCBI-GeneID: 114757
NCBI-ProteinID: NP_599030
OMIM: 608759
HGNC: 16505
Ensembl: ENSG00000161544
Pharos: Q8WWM9(Tbio)
UniProt: Q8WWM9 A0A1K0FUB6
Structure
Position
17:complement(76527356..76551193)
AA seq 190 aa
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
NT seq 573 nt   +upstreamnt  +downstreamnt
atggagaaagtgccaggcgagatggagatcgagcgcagggagcggagcgaggagctgtcc
gaggcggagaggaaggcggtgcaggctatgtgggcccggctctatgccaactgcgaggac
gtgggggtggccatcctggtgaggttctttgtgaacttcccctcggccaagcagtacttc
agccagttcaagcacatggaggatcccctggagatggagcggagcccccagctgcggaag
cacgcctgccgagtcatgggggccctcaacactgtcgtggagaacctgcatgaccccgac
aaggtgtcctctgtgctcgcccttgtggggaaagcccacgccctcaagcacaaggtggaa
ccggtgtacttcaagatcctctctggggtcattctggaggtggtcgccgaggaatttgcc
agtgacttcccacctgagacgcagagagcctgggccaagctgcgtggcctcatctacagc
cacgtgaccgctgcctacaaggaagtgggctgggtgcagcaggtccccaacgccaccacc
ccaccggccacactgccctcttcggggccgtag

DBGET integrated database retrieval system