KEGG   Homo sapiens (human): 114769Help
Entry
114769            CDS       T01001                                 

Gene name
CARD16, COP, COP1, PSEUDO-ICE
Definition
(RefSeq) caspase recruitment domain family member 16
  KO
K12806  caspase recruitment domain-containing protein 16/17/18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114769 (CARD16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD IKI3
Motif
Other DBs
NCBI-GeneID: 114769
NCBI-ProteinID: NP_001017534
OMIM: 615680
HGNC: 33701
Ensembl: ENSG00000204397
Vega: OTTHUMG00000166157
Pharos: Q5EG05(Tbio)
UniProt: Q5EG05
Position
11q22.3
AA seq 197 aa AA seqDB search
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDA
QRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYP
RIPGLGKELQTGTHKLS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggtcctgaaggagaagagaaagctgtttatccattccatgggtgaaggt
acaataaatggcttactggatgaattattacagacaagggtgctgaaccaggaagagatg
gagaaagtaaaacgtgaaaatgctacagttatggataagacccgagctttgattgactcc
gttattccgaaaggggcacaggcatgccaaatttgcatcacatacatttgtgaagaagac
agttacctggcagagacgctgggactctcagcagctcttcaggcagtgcaggacaaccca
gctatgcccacatgctcaagcccagaaggcagaatcaagctttgctttctagaagacgct
caaaggatatggaaacaaaagttgcagaggtgccatgttcagaatacaataataaagtgg
agtgaaagatatacttcaggcagttttgaaatgcagtggctttttcttagaaccaatttt
attgagcggttctggaggaacatacttctgctccccttgcataaaggatctctatatcct
agaatcccaggtttaggtaaagagttgcaaactggaactcataaattatcatag

DBGET integrated database retrieval system