KEGG   Homo sapiens (human): 114769
Entry
114769            CDS       T01001                                 
Symbol
CARD16, COP, COP1, LLID-114769, PSEUDO-ICE
Name
(RefSeq) caspase recruitment domain family member 16
  KO
K12806  caspase recruitment domain-containing protein 16/17/18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114769 (CARD16)
SSDB
Motif
Pfam: CARD EMC3_TMCO1
Other DBs
NCBI-GeneID: 114769
NCBI-ProteinID: NP_443121
OMIM: 615680
HGNC: 33701
Ensembl: ENSG00000204397
Pharos: Q5EG05(Tbio)
UniProt: Q5EG05
Position
11:complement(105041563..105045335)
AA seq 97 aa
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
NT seq 294 nt   +upstreamnt  +downstreamnt
atggccgacaaggtcctgaaggagaagagaaagctgtttatccattccatgggtgaaggt
acaataaatggcttactggatgaattattacagacaagggtgctgaaccaggaagagatg
gagaaagtaaaacgtgaaaatgctacagttatggataagacccgagctttgattgactcc
gttattccgaaaggggcacaggcatgccaaatttgcatcacatacatttgtgaagaagac
agttacctggcagagacgctgggactctcagcaggtccgatacctggaaattag

DBGET integrated database retrieval system