KEGG   Homo sapiens (human): 114780Help
Entry
114780            CDS       T01001                                 

Gene name
PKD1L2, PC1L2
Definition
(RefSeq) polycystin 1 like 2 (gene/pseudogene)
  KO
K04988  polycystin 1L2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    114780 (PKD1L2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   114780 (PKD1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel PLAT Gal_Lectin Lectin_C Ion_trans GPS REJ PKD
Motif
Other DBs
NCBI-GeneID: 114780
NCBI-ProteinID: NP_443124
OMIM: 607894
HGNC: 21715
Ensembl: ENSG00000166473
Vega: OTTHUMG00000166126
Pharos: Q7Z442(Tdark)
UniProt: Q7Z442
Position
16q23.2
AA seq 2459 aa AA seqDB search
MSAVGLVLLVLALRLRATTVKPEEGSFCSNSQVAFRDACYEFVPLGRTFRDAQSWCEGQG
GHLVFIQDEGTQWFLQKHISQDREWWIGLTWNLARNGTTEGPGTWLDTSNVTYSNWHGGQ
AAAAPDTCGHIGRGPSSEWVTSDCAQTFAFMCEFRVGQSLACEGLNATVHCGLGQVIQVQ
DAVYGRQNPHFCTQDAGRPSDLEQGCSWANVKEEVAGQCQELQSCQVAADETYFGNLCPT
QGSYLWVQYQCREALQLMVSSESFIFDNVTISLTWLLSPYIGNLSCIISTGDSHTFDPYN
PPSVSSNVTHQFTSPGEFTVFAECTTSEWHVTAQRQVTVRDKMETLSVTACSGLSQSGAG
PLCQAVFGDPLWIQVELDGGTGVTYTVLLGDITLAESTTQKGSLPYNLILDRETQKLMGP
GRHRLEIQATGNTTTSTISRNITVHLVELLSGLQASWASDHLELGQDLLITISLAQGTPE
ELTFEVAGLNATFSHEQVSFGEPFGICRLAVPVEGTFLVTMLVRNAFSNLSLEIGNITIT
APSGLQEPSGMNAEGKSKDKGDMEVYIQPGPYVDPFTTVTLGWPDNDKELRFQWSCGSCW
ALWSSCVERQLLRTDQRELVVPASCLPPPDSAVTLRLAVLRGQELENRAEQCLYVSAPWE
LRPRVSCERNCRPVNASKDILLRVTMGEDSPVAMFSWYLDNTPTEQAEPLLDACRLRGFW
PRSLTLLQSNTSTLLLNSSFLQSRGEVIRIRATALTRHAYGEDTYVISTVPPREVPACTI
APEEGTVLTSFAIFCNASTALGPLEFCFCLESGSCLHCGPEPALPSVYLPLGEENNDFVL
TVVISATNRAGDTQQTQAMAKVALGDTCVEDVAFQAAVSEKIPTALQGEGGPEQLLQLAK
AVSSMLNQEHESQGSGQSLSIDVRQKVREHVLGSLSAVTTGLEDVQRVQELAEVLREVTC
RSKELTPSAQWEASLALQHASEALLTVSAKARPEDQRRQAATRDLFQAVGSVLEASLSNR
PEEPAEASSSQIATVLRLLRVMEHVQTTLLLGKLPGGLPAMLATPSISVYTNRIQPWSWQ
GSSLRPDAADSATFMLPAASSLSSLEGGQEPVDIKIMSFPKSPFPARSHFDVSGTVGGLR
VTSPSGQLIPVKNLSENIEILLPRHSQRHSQPTVLNLTSPEALWVNVTSGEATLGIQLHW
RPDIALTLSLGYGYHPNKSSYDAQTHLVPMVAPDELPTWILSPQDLRFGEGVYYLTVVPE
SDLEPAPGRDLTVGITTFLSHCVFWDEVQETWDDSGCQVGPRTSPYQTHCLCNHLTFFGS
TFLVMSNAINIHQTAELFATFEDNPVVVTTVGCLCVVYVLVVIWARRKDAQDQAKVKVTV
LEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVD
AFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDC
VLDKVFPVATEQDRKQFSHLFFMKTSAGFQDGHIWYSIFSRCARSSFTRVQRVSCCFSLL
LCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIFQNTRP
RVAKEQNTGKWDRGSPNLTPSPQPMEDGLLTPEAVTKDVSRIVSSLFKALKVPSPALGWD
SVNLMDINSLLALVEDVIYPQNTSGQVFWEEAKKREDPVTLTLGSSEMKEKSQCPKPKAA
RSGPWKDSAYRQCLYLQLEHVEQELRLVGPRGFSQPHSHAQALRQLQTLKGGLGVQPGTW
APAHASALQVSKPPQGLPWWCILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISMA
VSFVESMFVTQPLKVLGFAAFFALVLKRVDDEEDTVAPLPGHLLGPDPYALFRARRNSSR
DVYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWMLLLVAYGQRDPSAYHLNRHL
QHSFTRGFSGVLGFREFFKWANTTLVSNLYGHPPGFITDGNSKLVGSAQIRQVRVQESSC
PLAQQPQAYLNGCRAPYSLDAEDMADYGEGWNATTLSEWQYQSQDQRQGYPIWGKLTVYR
GGGYVVPLGTDRQSTSRILRYLFDNTWLDALTRAVFVESTVYNANVNLFCIVTLTLETSA
LGTFFTHAALQSLRLYPFTDGWHPFVVAAELIYFLFLLYYMVVQGKRMSKETWGYFCSKW
NLLELAIILASWSALAVFVKRAVLAERDLQRCRNHREEGISFSETAAADAALGYIIAFLV
LLSTVKLWHLLRLNPKMNMITAALRRAWGDISGFMIVILTMLLAYSIASNLIFGWKLRSY
KTLFDAAETMVSLQLGIFNYEEVLDYSPVLGSFLIGSCIVFMTFVVLNLFISVILVAFSE
EQKYYQLSEEGEIVDLLLMKILSFLGIKSKREEPGSSREQPGSLSQTRHSRPAQALPKD
NT seq 7380 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagtgggcttggtactcctggtgcttgctctgaggcttagggccaccactgtt
aagccagaggaaggcagcttttgctctaacagccaggtggccttcagagatgcttgctat
gaatttgtgccactcggacgcaccttccgtgatgcccagagctggtgcgaggggcaagga
ggccatttggtcttcattcaggacgaaggcacccagtggtttctgcagaagcacatctcc
caggacagggaatggtggattggactcacgtggaacttggcacggaatggaaccacggag
gggccggggacttggttggacacctccaatgtgacctacagcaactggcatggagggcag
gccgccgctgcccctgacacctgcggccacatcgggagaggcccttcctctgagtgggtg
acctcggactgcgcccagaccttcgccttcatgtgcgagttccgggttggccagagcctg
gcctgcgagggactcaatgccaccgtgcactgtggcttggggcaggtcatccaggtccag
gatgccgtctacgggcgccagaatccccatttctgcacccaggatgccgggcgtccttca
gatctggagcagggatgcagctgggccaacgtcaaggaggaggtggcaggccagtgccag
gagctacagtcatgccaggtggcagcagatgagacctactttggaaacctgtgtccgact
cagggcagttacctgtgggtgcagtaccagtgccgggaagccctgcagctgatggtgtcc
agtgagagtttcatctttgacaatgtcaccatctccctgacgtggctcctctcaccctac
ataggaaacctgtcctgtataattagtacaggagacagccacacttttgatccctacaac
ccgccgagtgtgtccagcaatgtgacccaccagttcacatctcctggggaattcaccgtg
tttgctgaatgcacaaccagtgagtggcatgtgacagctcagaggcaggtgaccgtgcga
gacaagatggagacgctcagtgtgactgcatgctccggcctgtcccagtcaggagccggc
cctctctgccaggctgtctttggggatcctctgtggattcaggtggagcttgatggagga
acaggagtgacttacactgtgcttttgggtgacataaccctggccgagtccaccacccaa
aagggctcgctaccgtacaatctgatcctggacagagaaacccagaaactgatgggccct
gggaggcaccgcctggagatccaagccaccggcaacaccaccacctctacaatctccaga
aacattacagtccacttggtggagctgctgtcagggctgcaggcctcctgggcttctgac
catttggagcttggacaggacctattgatcaccatctcattggctcagggcaccccggaa
gagctgacctttgaggtggctggactcaatgcaaccttctcccacgagcaagtgagcttt
ggagagccatttgggatttgccgcctggctgttccggttgaaggcacctttctggtcacc
atgctggtgaggaatgccttctccaacctgagtttggaaatcgggaacatcactatcaca
gccccttccggtctccaagaaccatctgggatgaatgctgaaggaaagagtaaagataaa
ggcgatatggaggtgtacatccaacctggtccatatgtggatcctttcacgacagtgacc
ctgggctggccagacaatgacaaggagttacgcttccaatggtcatgtgggtcttgctgg
gctctgtggagcagctgtgttgagaggcagctgcttcgcacagaccagagggagctggtg
gttccagcatcctgcctgccgccgcctgactctgctgtcaccctgcgcctggctgttctg
agaggccaagagctggagaacagggcagagcagtgcctctacgtgtctgcgccctgggaa
ctcaggcctcgagtcagctgtgagaggaactgcaggccagttaatgccagcaaagacatt
ctgctcagggtcaccatgggggaggactctccagtggctatgttcagctggtatttggac
aacaccccaacagagcaggctgagcccctcctggatgcctgcagactcagaggattttgg
ccaaggtccttaaccctcctccagagcaacacctccacgttgctgttgaacagctcgttt
ctgcagtcccggggagaggtcatccgaatcagagccacagcactgaccaggcatgcctat
ggggaggacacctatgtgatcagcactgtgcctccccgtgaggtgcctgcctgcactatt
gccccagaggagggcaccgttctgacgagctttgccatcttctgcaacgcctccacagcc
ctgggacccctggagttctgcttctgtctggaatcaggttcctgcctacactgtggccct
gaacctgccctcccatcagtgtatctgccacttggagaggagaacaatgactttgtgctg
acagtagttatttctgccaccaatcgtgcaggggacacgcagcagacccaggccatggct
aaggtggcactcggagacacatgtgttgaggatgtagcattccaggctgccgtgtcagag
aaaatccccacagctctgcaaggcgagggtggccccgagcagctcctccagctggccaag
gctgtgtcctccatgctgaaccaagagcatgaaagccagggctcaggacagtcactgagc
atagacgtcagacagaaggtcagagagcatgtgctgggatcactgtctgcagtcaccacc
ggcttggaggacgtgcagagggtgcaggagctggccgaggtgctgagagaggtgacctgc
cggagtaaggaactcacaccctcggcccagtgggaggccagcttggctctacagcatgcc
agtgaggccctgttgacagtgagtgccaaggcccgccctgaggaccagaggcgccaggca
gccaccagggacctgtttcaggctgtgggcagtgtgctggaagcttccctgagcaacaga
ccagaagagcctgcggaggccagcagcagccagattgccacagtgctgcggctgcttcga
gtcatggagcatgtgcagaccaccctcctgctgggaaaactgccagggggccttccagcc
atgctggccaccccctccatctctgtgtacacaaacagaatacaaccctggagttggcaa
ggctcctccctgcgccctgatgccgcagactctgcaaccttcatgctgcccgctgcctcc
tccctcagctctctggagggcggccaggagcccgtggatataaagatcatgagtttccca
aagagcccctttccagcccgaagccactttgatgtcagcgggactgtcggtggcctccgt
gtgaccagccctagtggtcaactcatacctgtgaagaatctgtcggagaatatcgagatc
ctgctgccccggcattcacaaagacacagccagccgaccgtgttgaacctgaccagtcct
gaagctttgtgggtgaacgtgacttcaggggaggcaaccttggggatccagctgcactgg
agaccagacattgcactcacgcttagcctgggctatggctaccaccccaacaagagcagc
tacgatgcccaaactcacctcgtaccaatggtggctccagatgagctgcccacgtggatc
ctgagcccacaggacctgcgttttggagaaggggtctactatttgactgtggtccctgag
tctgacctggagccagcccccggcagggacctcacggttggcatcaccaccttcctgtct
cactgtgtgttctgggatgaggtccaggagacttgggacgactcaggatgccaggtgggg
cctcggaccagcccctaccagacacactgcctctgcaaccacctcactttcttcggaagc
acgttcctggtgatgtccaatgccatcaacatccaccagactgctgagctctttgccacc
tttgaggacaaccctgtggtcgtgaccaccgtgggctgcctgtgtgtggtctacgtgctg
gtggtgatctgggcgaggaggaaggacgctcaggatcaggccaaggtgaaggtcacagtg
ctggaagacaatgatccctttgctcagtaccactacctggtgacagtctacacaggacac
cgacgaggggcagccacgtcctcaaaggtgactgtcaccctgtatggcctggatggagag
agagagccccaccacctggctgatcccgacactccggtttttgagcgaggagcagtggat
gccttcctcctctccaccctgttccccctgggagaactgcggagcctccggctgtggcat
gacaactcaggggaccggccatcgtggtatgtgagccgggtgctggtctatgacctggtg
atggaccggaagtggtatttcctgtgcaactcctggctatccatcaatgttggagattgc
gtcctcgataaggtgtttcctgtggccacggagcaggacagaaaacaattcagccacctg
tttttcatgaagacttccgcgggcttccaggatggacacatctggtattcgatcttcagc
cgctgcgctcgcagcagcttcacccgcgtccagagggtgtcctgctgcttctccctgctg
ctgtgcaccatgctgaccagcatcatgttctggggggtccccaaggacccagctgagcaa
aagatggacttgggtaaaattgaattcacctggcaggaggtgatgattggcctggagagc
tccatcctcatgttccccatcaacctcctgattgttcagatctttcagaacacccgtccc
cgggtcgcgaaggagcagaacactggaaaatgggaccgggggtcccccaacctgactccc
tccccacagcccatggaggacggccttctgacacctgaggcagtgaccaaggatgtgtca
agaatcgtcagctccctcttcaaagctctcaaggtgccatcccccgccttgggctgggac
tcagtgaacttgatggacatcaacagtctcctcgccttggtggaagatgtcatttatcca
cagaacacatcagggcaggtgttctgggaggaagccaaaaagagagaggaccctgtaaca
ctcactttggggtcatcagaaatgaaagagaaatcacagtgtcccaagcccaaggcggca
cggagtggcccctggaaggacagcgcctacaggcagtgtctgtaccttcagctggaacac
gtggagcaagagctgcggctggtggggccccgaggcttctcccagccccacagccatgcc
caggccctcaggcagctgcagaccctgaagggcggcctgggggtacagccgggcacctgg
gcccctgcacatgccagcgctcttcaggtgagcaaaccccctcaaggcctgccctggtgg
tgcatcctggtgggctggctcctggtagcggccaccagtggcgtggcggccttcttcacc
atgctctacggcctgcactacgggagggccagctccctcaggtggctcatctccatggct
gtctccttcgtggagagcatgttcgtcacccagcccctgaaggtgctgggattcgctgct
ttctttgcactggtcttgaagagagtggacgatgaggaggatactgtggccccgctgcca
ggacatctgttgggcccagacccctatgccttgttccgagcacgaagaaacagcagcagg
gatgtctaccagccacctctcaccgctgccattgagaagatgaaaaccacccacctcaag
gaacagaaagcatttgccctcatcagagaaatcctggcatacttgggcttcctgtggatg
ctactgctcgtggcctacgggcagagggaccccagcgcctaccacctcaacagacacctc
cagcacagcttcaccaggggcttttcaggtgtgctcggcttccgagagttcttcaagtgg
gccaacaccaccctcgtgagtaacctgtatggtcaccccccaggctttatcactgatggg
aactccaagctggttggcagtgcccagattcgtcaagtgagggtccaggaaagctcttgc
cctcttgcccagcagccgcaggcatatctcaacggatgccgtgcaccatattccctggat
gctgaagacatggcagactatggggaaggctggaatgccaccaccctcagtgaatggcag
taccagagccaggaccaacgtcaagggtatcccatctggggcaaactcactgtgtaccgg
ggaggaggctacgtggtccccttggggactgatcgccaaagcacgtcaagaattctccgc
tatctctttgacaacacctggctggacgccctgaccagagctgtgtttgtggagtccact
gtctacaacgccaacgtcaacctgttctgcattgtcacgctgacgctagagaccagcgct
ctgggcaccttttttacgcacgcggccctgcagagcctccgcctgtaccccttcaccgac
ggctggcaccccttcgtggtagcggcagagctcatctacttcctcttcctcctctactac
atggtggtgcagggcaagcgcatgagtaaagagacgtggggctatttctgcagcaagtgg
aaccttctggagctggccatcatcctggccagctggagcgccctggcggtgtttgtgaag
agggctgtcctggccgaaagggacctccagcgctgccggaaccacagggaggaaggcatc
agcttcagtgagacagcagcagccgatgccgcccttggctacatcattgccttcctggta
ctcctgtccacagtgaagctttggcatctgctcaggttgaatcccaaaatgaacatgatc
acggcagccctacgccgtgcctggggcgacatttcaggctttatgattgtcatccttacc
atgctcctggcttactccatcgcgtcaaacttgatatttggttggaaactccgttcctac
aaaaccctctttgatgcggcggagacgatggtcagccttcagctgggaatcttcaactac
gaggaggtcctggactatagcccagtgcttggctccttcctcattggatcctgcattgtt
tttatgacatttgtggtgctgaacctgtttatctctgtcatcctggtggccttcagtgag
gagcaaaaatactatcagctgtcggaggaaggggagatcgtagatttgctgctgatgaaa
atactcagtttcctgggcattaagtctaagagagaggagcctggaagcagcagggagcag
cctgggtctctgtcccagactcgccactctcgaccagcacaagctttgcccaaggactaa

DBGET integrated database retrieval system