KEGG   Homo sapiens (human): 114789
Entry
114789            CDS       T01001                                 

Gene name
SLC25A25, MCSC, PCSCL, SCAMC-2
Definition
(RefSeq) solute carrier family 25 member 25
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    114789 (SLC25A25)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   114789 (SLC25A25)
SSDB
Motif
Pfam: Mito_carr EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg DUF2624 EF-hand_4 DUF1002
Other DBs
NCBI-GeneID: 114789
NCBI-ProteinID: NP_443133
OMIM: 608745
HGNC: 20663
Ensembl: ENSG00000148339
Vega: OTTHUMG00000020736
Pharos: Q6KCM7(Tbio)
UniProt: Q6KCM7
Position
9q34.11
AA seq 469 aa
MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD
KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE
KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE
RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGAR
SLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP
MEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETL
KNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS
SLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgctctgtctgtgcctgtatgtgccggtcatcggggaagcccagaccgagttccagtac
tttgagtcgaaggggctccctgccgagctgaagtccattttcaagctcagtgtcttcatc
ccctcccaggaattctccacctaccgccagtggaagcagaaaattgtacaagctggagat
aaggaccttgatgggcagctagactttgaagaatttgtccattatctccaagatcatgag
aagaagctgaggctggtgtttaagagtttggacaaaaagaatgatggacgcattgacgcg
caggagatcatgcagtccctgcgggacttgggagtcaagatatctgaacagcaggcagaa
aaaattctcaagagcatggataaaaacggcacgatgaccattgactggaacgagtggaga
gactaccacctcctccaccccgtggaaaacatccccgagatcatcctctactggaagcat
tccacgatctttgatgtgggtgagaatctaacggtcccggatgagttcacagtggaggag
aggcagacggggatgtggtggagacacctggtggcaggaggtggggcaggggccgtatcc
agaacctgcacggcccccctggacaggctcaaggtgctcatgcaggtccatgcctcccgc
agcaacaacatgggcatcgttggtggcttcactcagatgattcgagaaggaggggccagg
tcactctggcggggcaatggcatcaacgtcctcaaaattgcccccgaatcagccatcaaa
ttcatggcctatgagcagatcaagcgccttgttggtagtgaccaggagactctgaggatt
cacgagaggcttgtggcagggtccttggcaggggccatcgcccagagcagcatctaccca
atggaggtcctgaagacccggatggcgctgcggaagacaggccagtactcaggaatgctg
gactgcgccaggaggatcctggccagagagggggtggccgccttctacaaaggctatgtc
cccaacatgctgggcatcatcccctatgccggcatcgaccttgcagtctacgagacgctc
aagaatgcctggctgcagcactatgcagtgaacagcgcggaccccggcgtgtttgtgctc
ctggcctgtggcaccatgtccagtacctgtggccagctggccagctaccccctggcccta
gtcaggacccggatgcaggcgcaagcctctattgagggcgctccggaggtgaccatgagc
agcctcttcaaacatatcctgcggaccgagggggccttcgggctgtacagggggctggcc
cccaacttcatgaaggtcatcccagctgtgagcatcagctacgtggtctacgagaacctg
aagatcaccctgggcgtgcagtcgcggtga

DBGET integrated database retrieval system