KEGG   Homo sapiens (human): 114791
Entry
114791            CDS       T01001                                 

Gene name
TUBGCP5, GCP5
Definition
(RefSeq) tubulin gamma complex associated protein 5
  KO
K16572  gamma-tubulin complex component 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    114791 (TUBGCP5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    114791 (TUBGCP5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     114791 (TUBGCP5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     114791 (TUBGCP5)
SSDB
Motif
Pfam: GCP_C_terminal GCP_N_terminal DUF5601
Other DBs
NCBI-GeneID: 114791
NCBI-ProteinID: NP_001096080
OMIM: 608147
HGNC: 18600
Ensembl: ENSG00000275835
Vega: OTTHUMG00000188371
Pharos: Q96RT8(Tbio)
UniProt: Q96RT8
Position
15q11.2
AA seq 1024 aa
MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHK
IEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSIKEIKTDAHYSILSLLLCLSDS
PSNSSYVETPRNKEVEKKDDFDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSRE
DSGIQVDRTPLEEQDQNRKLDPCISWKDEPDDRSWLEHHVVHQYWTARPSQFPHSLHLHS
NLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSGVKKLFIFQLIDGKVTVRNNI
IVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVPKKSTEAPFRT
YQAFMWALYKYFISFKEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGV
AEVPPDTRNVVRASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQTVDEWI
VHGHLWDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQG
PSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESV
QSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDF
HEKFAGGDVCVDRSSESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMQTLKKDYRLVEYL
QAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSIS
FENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDV
LLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNY
IMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNL
ALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHCEYIMLKYFYL
CISL
NT seq 3075 nt   +upstreamnt  +downstreamnt
atggcgcggcacgggccaccgtggagtcggttggacgcgcagcaggagcgcgacgtgcgg
gagctcgtccggggtgtcgccggcctccaggacgaggcagaccccaacttccagctcgcc
ctaaacttcgcctggtccaacttcagatttcatcgtttcttggatgtcaacagccacaaa
atagaaaaaacaatcgaaggaatttatgaaaaatttgtcattcattctgatctaagcaaa
gctgctagttggaagagattaacggaggaatttctaaatgcaccacttcccagtataaag
gaaataaagacagatgcacattattccatactgtcacttcttctgtgtctgtcagactct
ccttcaaacagcagttatgtggagacaccaagaaataaagaagtggaaaagaaagatgat
ttcgactggggaaaatacttgatggaagatgaagaaatggacattggtccgtacatggac
acaccaaattggtctgaagaaagtgaagaggaaaatgatcaacagcccttaagcagagag
gactctggaattcaggtagacaggacaccgttagaagaacaagatcaaaacagaaaactg
gatccttgtatcagttggaaagatgagccagatgaccgaagctggctggaacatcatgtg
gtccatcagtactggacagccaggccctcccagtttcctcatagtttacatttgcactct
aatttagctgctgtctgggaccaacacttgtacagcagtgatccattgtatgttccagat
gacagggttttggttactgagactcaggttattcgggaaaccctatggttactttcagga
gtgaaaaagctctttatatttcagttgatagatgggaaggtaactgtgagaaacaatatt
atagtaactcatttaacacatagctgtttacgatctgtgctggaacaaatagcagcatat
ggccaggttgtgtttcgactccaggagttcattgatgaagtcatgggacacagttctgag
agcatgctgcctggaagtgggtctgttcctaagaagtcaactgaagctccctttagaacc
taccaggctttcatgtgggccctgtacaaatatttcattagtttcaaagaggaacttgca
gaaattgagaagtgcatcatcaataatgatactacaataactcttgcaatagtggtggac
aagttggcacctcgattgtctcagctcaaggttctgcacaaagtgtttagtactggagta
gcagaagttccacctgatactcgaaatgtcgtccgggcctctcacctgcttaacaccctg
tacaaggccattcttgaatatgacaatgttggagaagcctctgagcaaaccgtctccctc
cttttctctctctgggtggaaacggtgcggccttacctgcagacggtggacgagtggatc
gtgcacgggcacctgtgggatggcgccagggagttcatcatccagagaaacaaaaatgtt
ccagttaatcacagagacttctggtatgcaacttacacgttatatagcgtatcagaaaag
acagaaaatgaagaaaaaatgagtgataacgctagtgcgagttccggcagtgaccagggg
ccctccagcaggcagcacaccatggtgtccttcctcaaacctgtcctgaagcagatcata
atggctggcaagtcgatgcagctgctgaagaacctgcagtgtgcggagagcaccacctgc
caggcaggagccagagatgcagaaagaaaaagtttatacactctctttctggaatctgta
cagtcccgtcttcgacatggagaagattccactccacaggttcttactgagcaacaggca
accaaggagaacctgatgaagatgcagtccattgctgaaagccatcttgaactggatgat
gttcatgatccactgcttgccattaactttgcaaggatgtatttggagcagagtgacttt
cacgagaagtttgctggtggtgatgtatgtgtggatagatcatcggaatctgtgacatgc
cagacttttgaattaacgctgagatcctgcctctatcctcatattgacaagcagtatcta
gattgctgtggaaatctcatgcaaactctaaaaaaagattacaggttggtagaatacttg
caagctatgaggaattttttcttaatggaaggaggagataccatgtatgacttctacacg
tcaatttttgataaaataagagaaaaggaaacatggcagaatgtgtcttttcttaatgtc
caactccaagaagcagtaggacagcgttatcctgaagatagttcacgtctatctatatct
tttgaaaatgttgacacagctaagaagaagctgcctgttcatatcttagatggtctgacc
ctcagctacaaggtcccatggcccgtggacattgttataagtttggaatgtcaaaaaatt
tataatcaagtgtttcttctcttattgcaaataaagtgggcaaaatatagtctggatgtt
ttactttttggtgaactggttagtactgcagaaaaaccacgacttaaagaaggccttata
catgaacaagacacagttgctcagttcggaccacaaaaagaaccagtaagacagcagatt
catcgcatgttcctcttaagagtgaagctcatgcatttcgtgaacagcttgcacaactac
atcatgaccaggattctacacagtacagggctggagtttcaacatcaagtcgaggaagcc
aaggatttagatcaattgattaaaattcactataggtatctgtcaaccatccatgaccgg
tgtctgctgagagaaaaggtcagctttgtgaaagaagctatcatgaaggtgttgaacttg
gctctcatgtttgcagacggttggcaggcaggcctgggcacttggcgaatggaatctata
gagaaaatggaatctgattttaaaaactgccatatgtttcttgtaaccattttaaacaaa
gccgtctgtagaggatcctttccccattgtgagtatatcatgttaaaatatttctacctc
tgtatttccttgtaa

DBGET integrated database retrieval system