KEGG   Homo sapiens (human): 114799Help
Entry
114799            CDS       T01001                                 

Gene name
ESCO1, A930014I12Rik, CTF, ECO1, EFO1, ESO1
Definition
(RefSeq) establishment of sister chromatid cohesion N-acetyltransferase 1
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    114799 (ESCO1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     114799 (ESCO1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Adherin complex
    114799 (ESCO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_13 zf-C2H2_3
Motif
Other DBs
NCBI-GeneID: 114799
NCBI-ProteinID: NP_443143
OMIM: 609674
HGNC: 24645
Ensembl: ENSG00000141446
Vega: OTTHUMG00000178919
Pharos: Q5FWF5(Tbio)
UniProt: Q5FWF5 A0A024RC19
Structure
PDB: 

Position
18q11.2
AA seq 840 aa AA seqDB search
MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQP
ELETRMSTRSSKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNR
RSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVL
EVKSDSKEDENLVINEVINSPKGKKRKVEHQTACACSSQCTQGSEKCPQKTTRRDETKPV
PVTSEVKRSKMATSVVPKKNEMKKSVHTQVNTNTTLPKSPQPSVPEQSDNELEQAGKSKR
GSILQLCEEIAGEIESDNVEVKKESSQMESVKEEKPTEIKLEETSVERQILHQKETNQDV
QCNRFFPSRKTKPVKCILNGINSSAKKNSNWTKIKLSKFNSVQHNKLDSQVSPKLGLLRT
SFSPPALEMHHPVTQSTFLGTKLHDRNITCQQEKMKEINSEEVKINDITVEINKTTERAP
ENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKI
DTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEITIPKDLKLKEAEKT
DEKQLIIDAGQKRFGAVSCNVCGMLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILA
EYPDGRIIMVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVG
CLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRR
KKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccattcaggagaaatcaaaagagaattcctccaaagttactaaaaaaagtgac
gataagaattcagaaacagaaattcaggattctcaaaagaatctagcaaaaaaatcaggt
ccaaaggagactataaaatcacaggctaaatcttccagtgaaagtaaaataaatcagcca
gaattggaaacacgcatgagtacaaggtcatcaaaggcagcatctaatgataaagctact
aaatccattaataaaaatacggtgactgtgaggggatattcacaagaatctacaaaaaag
aaattatctcagaaaaaattagtacatgaaaaccctaaagcaaatgaacagcttaaccgg
agatcacaaaggctacaacaattaacagaggtttcaagaaggtcgttacgcagtagagaa
attcagggtcaagttcaagcagttaaacagagtttgccaccaactaaaaaagagcagtgt
agcagtactcagagtaaatctaataaaacaagtcaaaaacatgtgaagagaaaagtactg
gaagtaaagtctgactctaaagaagatgaaaatctagtaattaatgaagtaataaattct
cccaaagggaaaaaacgcaaggtagaacatcagacagcttgtgcttgtagttctcaatgc
acgcaaggatctgaaaagtgtcctcagaagactactagaagagacgaaacgaaacctgtg
cctgtaacttctgaggtgaaaagatcaaaaatggctacttcagtggtcccgaaaaagaat
gagatgaagaagtcggttcatacacaagtgaatactaacacaacactcccaaaaagtcca
cagccatcagtgcctgaacaaagtgataatgagctggagcaagcaggaaagagcaaacga
ggtagtattctccagctctgtgaagaaattgctggtgaaattgagtcagataatgtagag
gtaaaaaaggaatcttcacaaatggaaagtgtaaaggaagaaaagcccacagaaataaaa
ttggaagagaccagtgttgaaagacaaatacttcatcagaaggaaacaaatcaggatgtg
caatgtaatcgttttttcccaagtagaaaaacaaagcctgtgaaatgtatactaaatgga
ataaacagctcagccaagaagaactccaactggactaaaattaaactctcaaaatttaac
tctgtgcagcacaataagttggactctcaagtttcccctaaattaggcttattacgaacc
agtttttcaccaccagctttagaaatgcatcatccagtgactcaaagtacgtttttaggg
acaaagctacatgatagaaatataacttgccagcaggaaaaaatgaaagaaattaattct
gaagaagtgaaaattaatgatattacagtagaaattaataaaaccacagaaagggctcct
gaaaattgtcatttggccaatgagataaaaccttctgacccaccattggataatcagatg
aaacattcttttgattcagcatcaaataagaatttcagccaatgtttggaatccaagcta
gaaaacagtccagtggaaaatgttactgctgcttcgactctgctcagtcaagcaaaaatt
gatacaggagagaataaatttccaggttcagctccccaacagcatagtattctcagtaac
cagacatctaaaagcagtgataacagggagacaccacgaaatcattctttgcctaagtgt
aattcccatttggagataacaattccaaaggacttgaaactaaaagaagcagagaaaact
gatgaaaaacagttgattatagatgcaggacaaaaaagatttggagcagtttcttgtaat
gtttgtggaatgctgtatacagcttcaaatccagaagatgaaacacagcatctgcttttc
cacaaccagtttataagtgctgttaaatatgtgggctggaagaaagaaagaattctggct
gaataccctgatggcaggataataatggttcttcctgaagacccaaagtatgccctgaaa
aaggttgacgagattagagagatggttgacaatgatttaggttttcaacaggctccacta
atgtgctattccagaactaaaacacttctcttcatttccaatgacaaaaaagtagttggc
tgcctaattgcggaacatatccaatggggctacagagttatagaagagaaacttccagtt
atcaggtcagaagaagaaaaagtcagatttgaaaggcaaaaagcctggtgctgctcaaca
ttaccagagcctgcaatctgcgggatcagtcgaatatgggtattcagcatgatgcgtcgg
aagaaaattgcttctcgcatgattgaatgcctaaggagtaactttatatatggctcatat
ttgagcaaagaagaaattgctttctcagatcccactcctgatggaaagctgtttgcaaca
cagtactgtggcactggtcaatttctggtatataattttattaatggacagaatagcacg
taa

DBGET integrated database retrieval system