KEGG   Homo sapiens (human): 114805Help
Entry
114805            CDS       T01001                                 

Gene name
GALNT13, GalNAc-T13
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 13
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    114805 (GALNT13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    114805 (GALNT13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     114805 (GALNT13)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   114805 (GALNT13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 114805
NCBI-ProteinID: NP_443149
OMIM: 608369
HGNC: 23242
Ensembl: ENSG00000144278
Vega: OTTHUMG00000131917
Pharos: Q8IUC8(Tbio)
UniProt: Q8IUC8
Position
2q23.3-q24.1
AA seq 556 aa AA seqDB search
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRN
YFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHV
INKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDL
CLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCS
GSRSQQWLLRNMTLGT
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaggagatttgtctactgcaaggtggttctagccacttcgctgatgtgggttcttgtt
gatgtcttcttactgctgtacttcagtgaatgtaacaaatgtgatgacaagaaggagaga
tctctgctgcctgcattgagggctgttatttcaagaaaccaagaagggccaggagaaatg
ggaaaagctgtgttgattcctaaagatgaccaggagaaaatgaaagagctgtttaaaatc
aatcagtttaaccttatggccagtgatttgattgcccttaatagaagtctgccagatgta
agattagaaggatgtaagacaaaagtctaccctgatgaacttccaaacacaagtgtagtc
attgtgtttcataatgaagcttggagcactctccttagaactgtttacagtgtgataaat
cgttccccacactatctactctcagaggtcatcttggtagatgatgccagtgaaagagat
tttctcaagttgacattagagaattacgtgaaaaatttagaagtgccagtaaaaattatt
aggatggaagaacgctctgggttaatacgtgcccgtcttcgaggagcagctgcttcaaaa
gggcaggtcataacttttcttgatgcacactgtgaatgcacgttaggatggctggagcct
ttgctggcaagaataaaggaagacaggaaaacggttgtctgccctatcattgatgtgatt
agtgatgatacttttgaatatatggctgggtcagacatgacttatgggggttttaactgg
aaactgaatttccgctggtatcctgttccccaaagagaaatggacaggaggaaaggagac
agaacattacctgtcaggacccctactatggctggtggcctattttctattgacagaaac
tactttgaagagataggaacttacgatgcaggaatggatatctggggtggagagaatctt
gaaatgtcttttaggatttggcaatgtggaggctccttggagattgttacttgctcccat
gttggtcatgtttttcggaaggcaactccatacacttttcctggtggcactggtcatgtc
atcaacaagaacaacaggagactggcagaagtttggatggatgaatttaaagatttcttc
tacatcatatccccaggtgttgtcaaagtggattatggagatgtgtcagtcagaaaaaca
ctaagagaaaatctgaagtgtaagcccttttcttggtacctagaaaacatctatccggac
tcccagatcccaagacgttattactcacttggtgagataagaaatgttgaaaccaatcag
tgtttagacaacatgggccgcaaggaaaatgaaaaagtgggtatattcaactgtcatggt
atgggaggaaatcaggtattttcttacactgctgacaaagaaatccgaaccgatgacttg
tgcttggatgtttctagactcaatggacctgtaatcatgttaaaatgccaccatatgaga
ggaaatcagttatgggaatatgatgctgagagactcacgttgcgacatgttaacagtaac
caatgtctcgatgaaccttctgaagaagacaaaatggtgcctacaatgcaggactgtagt
ggaagcagatcccaacagtggctgctaaggaacatgaccttgggcacatga

DBGET integrated database retrieval system