KEGG   Homo sapiens (human): 114822Help
Entry
114822            CDS       T01001                                 

Gene name
RHPN1, ODF5, RHOPHILIN, RHPN
Definition
(RefSeq) rhophilin Rho GTPase binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BRO1 HR1 PDZ PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 114822
NCBI-ProteinID: NP_443156
OMIM: 601031
HGNC: 19973
Ensembl: ENSG00000158106
Vega: OTTHUMG00000165006
Pharos: Q8TCX5(Tbio)
UniProt: Q8TCX5
Position
8q24.3
AA seq 670 aa AA seqDB search
MILEERPDGAGAGEESPRLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQMRTGAENLYRA
TSNNRVRETVALELSYVNSNLQLLKEELEELSGGVDPGRHGSEAVTVPMIPLGLKETKEL
DWSTPLKELISVHFGEDGASYEAEIRELEALRQAMRTPSRNESGLELLTAYYNQLCFLDA
RFLTPARSLGLFFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDRSCTEGAR
RAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAP
QDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAEYFRSLAHYHVA
MALCDGSPATEGELPTHEQVFLQPPTSSKPRGPVLPQELEERRQLGKAHLKRAILGQEEA
LRLHALCRVLREVDLLRAVISQTLQRSLAKYAELDREDDFCEAAEAPDIQPKTHQKPEAR
MPRLSQGKGPDIFHRLGPLSVFSAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIP
GSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTELKAAGEAGASLQVVSLLPSSRLPSLG
DRRPVLLGPRGLLRSQREHGCKTPASTWASPRPLLNWSRKAQQGKTGGCPQPCAPVKPAP
PSSLKHPGWP
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggaggagaggccggacggcgcgggcgccggcgaggagagcccgcggctgcag
ggctgtgactccctgacgcagatccagtgcggccagctgcagagccgcagggcccagatt
caccagcagattgacaaggagctgcagatgcggacgggcgctgagaacctctacagagcc
accagcaacaaccgggtgagagagacggtcgccctggagctgagctacgtcaactccaac
ctgcagctgctgaaggaggagctggaggagctcagcggtggcgtggaccctggccggcat
gggagcgaagctgtcactgtccccatgatccccctgggcctgaaggagaccaaggagctg
gactggtctacaccgctgaaggagctgatctcagtgcactttggagaggacggcgcctcc
tacgaggcagaaatcagggagctggaggccctgcggcaggccatgcggacccccagccgg
aatgagtcgggcctggagctgctcacagcctattacaaccagctgtgcttcctggatgcg
cgcttcctcacccctgccaggagcctcgggctcttcttccactggtacgactcgcttact
ggggtcccggcccagcagcgtgccctggccttcgagaagggcagcgttctcttcaacatc
ggtgccctccacacgcagattggggcgcgccaggaccgctcctgcaccgagggtgcccgc
cgcgctatggaggccttccagagggccgctggggccttcagcctcctgagggagaacttc
tcccatgcgccgagcccagacatgagcgctgcgtccctctgcgcactggagcagctcatg
atggcccaggcccaggaatgtgtgtttgagggcctctcaccacctgcctccatggccccc
caagactgcctggcccagctgcgcctggcgcaggaggccgcccaggtggcagccgagtac
aggctagtgcaccggaccatggcccagccacccgtccacgactacgtgcctgtctcctgg
actgccctggtgcatgtcaaggccgagtacttccgctccctggcccactaccacgtagcc
atggccctctgcgacggctccccagcgaccgagggagagctccccacgcacgagcaggtc
ttcctgcagccccccacctcctctaagccccgaggccctgtgctgccgcaggagctggag
gagcgcaggcagcttggcaaggcacacctgaagcgtgccatcctggggcaggaggaggcg
ctgcggctgcacgccctgtgccgcgtcctgcgcgaggtggacctgcttcgggctgtgatc
tcccagacgctgcagcgctcactggccaagtatgcggagctcgaccgtgaggatgacttc
tgtgaggctgccgaggccccggacatccagcctaagacccaccagaagccagaggccagg
atgccacgcctgtcccaggggaaggggcctgacatcttccatcggctggggcccctgtct
gtgttctcagccaagaaccggtggcggctggtggggcccgtccacctgacccgaggagag
ggcggctttggcctcacgcttcggggagactcgcctgtcctcatcgctgccgtcattcca
gggagccaggccgcggcggctggcctgaaggagggcgactacattgtgtcagtgaatggg
cagccatgcaggtggtggagacacgcggaggtggtgacggagctgaaggctgcgggagag
gcgggcgccagcctgcaggtggtgtcgctgctgcccagctctagactgcccagcttgggg
gaccgccggcccgtcctgctgggccccagggggcttctaaggagccagagggagcatggt
tgcaagaccccggcatccacgtgggccagtccccggcccctcctcaactggagccgaaag
gcccagcagggcaagactggaggctgcccccagccctgtgccccagtgaagccagctccg
ccctcatccttgaagcacccagggtggccgtga

DBGET integrated database retrieval system