KEGG   Homo sapiens (human): 114879
Entry
114879            CDS       T01001                                 
Symbol
OSBPL5, OBPH1, ORP5
Name
(RefSeq) oxysterol binding protein like 5
  KO
K20464  oxysterol-binding protein-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    114879 (OSBPL5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114879 (OSBPL5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    114879 (OSBPL5)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    114879 (OSBPL5)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   114879 (OSBPL5)
SSDB
Motif
Pfam: Oxysterol_BP PH
Other DBs
NCBI-GeneID: 114879
NCBI-ProteinID: NP_065947
OMIM: 606733
HGNC: 16392
Ensembl: ENSG00000021762
Pharos: Q9H0X9(Tbio)
UniProt: Q9H0X9
Position
11:complement(3087107..3165310)
AA seq 879 aa
MKEEAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDE
GPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLKAQKENYRQEKKRATRQLLSA
LTDPSVVIMADSLKIRGTLKSWTKLWCVLKPGVLLIYKTPKVGQWVGTVLLHCCELIERP
SKKDGFCFKLFHPLDQSVWAVKGPKGESVGSITQPLPSSYLIFRAASESDGRCWLDALEL
ALRCSSLLRLGTCKPGRDGEPGTSPDASPSSLCGLPASATVHPDQDLFPLNGSSLENDAF
SDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEELGELGEASQV
ETVSEENKSLMWTLLKQLRPGMDLSRVVLPTFVLEPRSFLNKLSDYYYHADLLSRAAVEE
DAYSRMKLVLRWYLSGFYKKPKGIKKPYNPILGETFRCCWFHPQTDSRTFYIAEQVSHHP
PVSAFHVSNRKDGFCISGSITAKSRFYGNSLSALLDGKATLTFLNRAEDYTLTMPYAHCK
GILYGTMTLELGGKVTIECAKNNFQAQLEFKLKPFFGGSTSINQISGKITSGEEVLASLS
GHWDRDVFIKEEGSGSSALFWTPSGEVRRQRLRQHTVPLEEQTELESERLWQHVTRAISK
GDQHRATQEKFALEEAQRQRARERQESLMPWKPQLFHLDPITQEWHYRYEDHSPWDPLKD
IAQFEQDGILRTLQQEAVARQTTFLGSPGPRHERSGPDQRLRKASDQPSGHSQATESSGS
TPESCPELSDEEQDGDFVPGGESPCPRCRKEARRLQALHEAILSIREAQQELHRHLSAML
SSTARAAQAPTPGLLQSPRSWFLLCVFLACQLFINHILK
NT seq 2640 nt   +upstreamnt  +downstreamnt
atgaaggaggaggccttcctccggcgccgcttctccctgtgtccaccttcctccacccct
cagaaagtcgacccccggaagctcacccggaacttgctcctcagcggagacaatgagctc
tacccactcagcccagggaaggacatggagcccaacggcccgtcgctgcccagggatgaa
gggcccccgaccccaagctctgccacgaaggtgccaccggcagagtacaggctgtgcaac
gggtcagacaaggaatgtgtgtcccccaccgccagggtcaccaagaaggagactctcaag
gcgcagaaggagaactaccggcaggagaagaagcgcgccacacggcagctgctcagcgct
ctgacagaccccagcgtggtcatcatggctgacagcctgaagatccgcggcaccctgaag
agctggaccaagctgtggtgcgtgctgaagccgggggtgctgctcatctacaagacgccc
aaggtgggccagtgggtgggcacggtgctgctgcactgctgcgagctcatcgagcggccc
tccaagaaggacggcttctgcttcaagctcttccacccgctggatcagtccgtctgggcc
gtgaagggccccaaaggtgagagcgtgggctccatcacacagcccctgcccagcagctac
ctgatcttcagggccgcctccgagtcagatggtcgctgctggctggacgccctggagctg
gccctgcgctgctctagcctactgagactgggcacctgcaagccgggccgagacggggag
ccagggacctcgccagacgcatcaccctcatcgctctgtgggctgccagcctcagccacc
gtccacccagaccaagacctgttcccactgaacgggtcttccctggagaacgatgcattc
tcagacaagtcggagagagagaaccctgaggagtcagataccgagacccaggaccatagc
cggaagacggagagtggcagcgaccagtcagagacccctggggccccggtgcggagaggg
accacctatgtggagcaggtccaggaggagctgggggagctgggcgaggcgtcccaggtg
gagacagtgtcagaggagaacaagagtctgatgtggaccctgctgaagcagctacggcca
ggcatggacctgtcccgcgtggtgctacccacgttcgtactggagccgcgctccttcctg
aacaagctctccgactactactaccacgcagacctgctctccagggctgcggtggaggag
gatgcctacagccgcatgaagctggtgctgcggtggtacctgtctggcttctacaagaag
cccaagggaatcaagaagccgtacaaccccatcctgggggagaccttccgctgctgctgg
ttccacccgcagactgacagccgcacattctacatagcagagcaggtgtcccaccacccg
cccgtgtctgccttccacgtcagcaaccggaaggacggcttctgcatcagtggcagcatc
acagccaagtccaggttttatgggaactcgctgtcggcgctgctggacggcaaagccacg
ctcaccttcctgaaccgagccgaggattacacccttaccatgccctacgcccactgcaaa
ggaatcctgtatggcacgatgaccctggagctgggtgggaaggtcaccatcgagtgtgcg
aagaacaacttccaggcccagctggaattcaaactcaagcccttcttcgggggtagcacc
agcatcaaccagatctcgggaaagatcacgtcgggagaggaagtcctggcgagcctcagt
ggccactgggacagggacgtgtttatcaaggaggaagggagcggaagcagtgcgcttttc
tggaccccgagcggggaggtccgcagacagaggctgaggcagcacacggtgccgctggag
gagcagacggagctggagtccgagaggctctggcagcacgtcaccagggccatcagcaag
ggcgaccagcacagggccacacaggagaagtttgcactggaggaggcacagcggcagcgg
gcccgtgagcggcaggagagcctcatgccctggaagccgcagctgttccacctggacccc
atcacccaggagtggcactaccgatacgaggaccacagcccctgggaccccctgaaggac
atcgcccagtttgagcaagacgggatcctgcggaccttgcagcaggaggccgtggcccgc
cagaccaccttcctgggcagcccagggcccaggcacgagaggtctggcccagaccagcgg
cttcgcaaggccagcgaccagccctccggccacagccaggccacggagagcagcggatcc
acgcctgagtcctgcccagagctctcagacgaggagcaggatggtgactttgtccctggc
ggtgagagcccatgccctcggtgcaggaaggaggcgcggcggctgcaggccctgcacgag
gccatcctctccatccgagaggcccagcaggagctgcacaggcacctctcggccatgctg
agctccacggcacgggcagcacaggcaccgaccccaggcctcctgcagagcccccgatcc
tggttcctgctctgcgtgttcctggcgtgtcagctgttcattaaccacatcctcaaatag

DBGET integrated database retrieval system