KEGG   Homo sapiens (human): 114880
Entry
114880            CDS       T01001                                 
Symbol
OSBPL6, ORP6
Name
(RefSeq) oxysterol binding protein like 6
  KO
K20463  oxysterol-binding protein-related protein 3/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114880 (OSBPL6)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    114880 (OSBPL6)
SSDB
Motif
Pfam: Oxysterol_BP PH_8 PH PNMA
Other DBs
NCBI-GeneID: 114880
NCBI-ProteinID: NP_115912
OMIM: 606734
HGNC: 16388
Ensembl: ENSG00000079156
Pharos: Q9BZF3(Tbio)
UniProt: Q9BZF3
Position
2:178193774..178402893
AA seq 934 aa
MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQSIHILERTASSSTEPSVSRQLLEPEP
VPLSKEADSWEIIEGLKIGQTNVQKPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSK
APLDIQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHR
LYRQNEIVRSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPAT
CTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQAN
CVDISKKDKRVTRRWRTKSVSKDTKIQLQVPFSATMSPVRLHSSNPNLCADIEFQTPPSH
LTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQM
ARLRQSLSQALNQNAELRSRLNRIHSESIICDQVVSVNIIPSPDEAGEQIHVSLPLSQQV
ANESRLSMSESVSEFFDAQEVLLSASSSENEASDDESYISDVSDNISEDNTSVADNISRQ
ILNGELTGGAFRNGRRACLPAPCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQ
HLCEEMEYSELLDKASETDDPYERMVLVAAFAVSGYCSTYFRAGSKPFNPVLGETYECIR
EDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIRWKNKFWGKSMEILPVGTLNVMLPKY
GDYYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTKSSVCICKLTFVKVNYWNSNMNEVQG
VVIDQEGKAVYRLFGKWHEGLYCGVAPSAKCIWRPGSMPTNYELYYGFTRFAIELNELDP
VLKDLLPPTDARFRPDQRFLEEGNLEAAASEKQRVEELQRSRRRYMEENNLEHIPKFFKK
VIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgagttcagatgagaagggcatttcccctgctcataaaacatccactccaacccataga
agtgcctcctcttcaacatcctcccaaagggacagtaggcagagtattcacatactggag
aggactgcttcctctagcaccgagccctctgtaagtcggcaattgctagaaccggagcca
gtccccctctccaaggaagctgacagctgggaaattatagaagggctgaaaataggccaa
accaatgtccagaaaccagacaaacatgagggctttatgctgaagaaaagaaaatggcct
ttaaaaggctggcacaagcgtttttttgtcctggataatggaatgttaaagtattcaaag
gcaccactcgatattcagaaaggaaaggtccatgggagcatagatgtgggactctcagtc
atgtcaattaaaaagaaagctcgaagaatagaccttgacaccgaagagcacatctatcat
ttgaaggtgaaatcccaggactggtttgatgcatgggtctccaaactgcgacatcatcgg
ttgtatcgtcagaatgaaattgtgagatcaccaagagatgctagttttcacatatttcct
tcaacgtccacagctgaatcctcaccagctgctaatgtttctgtaatggatggaaagatg
caaccaaacagctttccgtggcagtcccctttaccatgcagcaatagcctccctgcaacg
tgcacaactggccagagtaaagtggcagcctggttacaggactcggaagagatggacagg
tgtgcagaagatcttgcacattgccagtcaaaccttgtggaacttagcaaactcctgcaa
aatttggaaatacttcagagaactcagtcggcacctaactttactgacatgcaggctaac
tgtgtagatatttcaaagaaagacaagcgggtcacaagacgatggagaacaaaaagtgtc
agcaaagatacaaaaatacaactgcaggttcctttcagtgctaccatgtcaccagttcgc
ttgcattcctccaaccccaacctttgtgcagatattgaatttcagactccccctagccac
ctcactgaccctctggaaagttcaacagattatacaaagctgcaagaagaattttgtcta
atcgcacagaaagtgcattctcttttgaagtctgcatttaatagcatagctatagagaag
gagaagctgaagcagatggtttccgagcaggatcacagtaaaggccacagcacgcagatg
gcacggctccgacagtcactgtctcaggcactcaaccagaatgctgaactaaggagtcgg
ttgaacagaatacattcagagtctattatttgtgatcaggttgtcagtgtaaatattatt
cctagccctgatgaggctggtgagcaaatccatgtcagtctccccttatcacagcaagta
gccaatgagagccgcctctccatgtcagagtctgtttctgagttctttgatgcccaagag
gtgctcctctctgcaagttcgtcagagaatgaggcttcagatgatgagtcttacatcagt
gatgtgagtgataatatatctgaagacaacaccagtgttgcagacaatatttctcggcaa
atcctgaatggggagcttacaggaggggccttccgaaatgggcgtcgagcatgcctgcca
gctccttgtcctgacaccagtaacattaacctgtggaatatcttgaggaacaacattggt
aaagacctgtctaaagtctctatgcctgtggagctaaacgagccgctcaacaccctgcag
cacctctgtgaggaaatggaatacagcgagctcctggacaaggcttcggaaactgatgat
ccatatgagcgcatggttctcgttgccgcatttgcagtttcaggatactgctccacctat
ttcagagcaggaagtaagccattcaacccagtccttggggagacttatgaatgcattaga
gaagacaagggattccgctttttctcagaacaggttagccatcatccacccatttctgcc
tgtcactgtgaatcaaagaattttgtgttttggcaagatatcagatggaaaaacaagttc
tgggggaagtcgatggaaatcctgcctgttggaacactgaatgtcatgcttccaaagtat
ggagattactatgtgtggaataaagtcaccacttgcatacacaacatcctcagtgggaga
agatggatagaacattatggagaagtaaccatcagaaataccaaaagcagtgtttgcatt
tgcaaactcacatttgtcaaggtgaattattggaattctaacatgaatgaagtccagggg
gtggtgatagatcaggaggggaaggcggtgtaccggctgtttggaaagtggcatgaagga
ctctactgtggtgtggccccctctgcaaagtgcatttggagaccaggttccatgccaaca
aactatgagctgtactatggcttcacaaggtttgctattgagctcaatgagttagatcca
gtactaaaagatctccttccaccaacagacgcccggttccggccagatcaaagatttttg
gaagaaggaaatttagaagctgcagcatcagagaagcaaagagtagaggaactccagaga
tctcggagacgatatatggaagaaaacaatcttgaacatataccaaaattttttaaaaaa
gttattgatgccaatcaaagagaagcctgggtttctaacgacacctactgggagcttcga
aaggaccctgggtttagcaaagtagacagccctgttctttggtag

DBGET integrated database retrieval system