KEGG   Homo sapiens (human): 114882
Entry
114882            CDS       T01001                                 
Symbol
OSBPL8, MST120, MSTP120, ORP8, OSBP10
Name
(RefSeq) oxysterol binding protein like 8
  KO
K22285  oxysterol-binding protein-related protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114882 (OSBPL8)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    114882 (OSBPL8)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    114882 (OSBPL8)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   114882 (OSBPL8)
SSDB
Motif
Pfam: Oxysterol_BP PH
Other DBs
NCBI-GeneID: 114882
NCBI-ProteinID: NP_065892
OMIM: 606736
HGNC: 16396
Ensembl: ENSG00000091039
Pharos: Q9BZF1(Tbio)
UniProt: Q9BZF1 A0A024RBB8
Structure
Position
12:complement(76351797..76559771)
AA seq 889 aa
MEGGLADGEPDRTSLLGDSKDVLGPSTVVANSDESQLLTPGKMSQRQGKEAYPTPTKDLH
QPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSSTSSKLTKKES
LKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYK
TQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPS
SYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRA
NNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVMGKSEESDTDTSER
QDDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDL
SKVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGL
KKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKS
KFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGTVNITCQKTGY
SAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFITDKKTDNSEVFWNPT
PDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEATQEKYVLEEAQRQAARDR
KTKNEEWSCKLFELDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVP
KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQT
QEEIKRNIMALRNHLVSSTPATDYFLQQKDYFIIFLLILLQVIINFMFK
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggagggaggtttggcagatggagaacctgatcgaacttcgcttcttggtgatagcaaa
gatgtccttgggccatcaactgttgtagcaaacagtgacgaatctcagcttctgacacca
ggaaagatgagtcagcgccaaggaaaagaagcttatccaacgccaaccaaagatttgcat
cagccatctcttagtccagcaagtcctcatagccagggttttgaaagagggaaggaagat
atttctcaaaataaagatgaatcttcactttctatgtcaaagagcaagtctgaatctaaa
ctttataatggctcagagaaggacagttcaacttcaagcaaactcacaaaaaaagaatct
cttaaggtacaaaagaaaaattaccgagaagaaaagaaaagagccacaaaggagctgctc
agtacaatcacagatccttctgttattgttatggctgattggttaaagattcgtggtact
ctaaagagctggaccaagttatggtgtgtgttgaaacctggggtgctactgatctataaa
acccaaaaaaatggtcagtgggtaggaacagttcttctgaatgcctgtgaaatcattgaa
cgtccatcaaaaaaggatggcttttgtttcaaacttttccatcctttggagcaatctatt
tgggcagtgaagggtccaaaaggtgaagcggttggatccattactcaacccttacctagc
agttatttgatcatccgagctacttcagagtcagatggaaggtgctggatggatgctttg
gagttggctttgaaatgttctagtcttcttaaacgtacaatgatcagagaaggaaaggaa
catgacctgagcgtttcatcagatagcacacatgtgactttctatggcttactacgtgct
aacaatctccacagtggtgataacttccagttaaatgatagtgaaattgaacgacaacat
tttaaggaccaagatatgtattctgataaatctgataaagaaaatgatcaagaacatgat
gagtctgataatgaggtgatggggaaaagtgaagaaagtgacacagatacatcagaaaga
caagatgactcatatatcgaacctgagcctgttgagcctttaaaggagactacctacact
gaacagagccatgaagaacttggagaggcaggtgaggcttctcaaacagaaactgtatct
gaagaaaacaaaagccttatctggacactattgaaacaagtccgtcctggcatggaccta
tccaaggtggttctgcctacatttattttggaaccccgttctttcctggataaactttca
gattactactatcatgcagatttcctatctgaggcagctcttgaagaaaatccttatttc
cgtttgaagaaagtagtgaaatggtatttgtcaggattctataaaaagccaaagggactg
aagaaaccttataatcctatacttggcgagactttccgttgtttatggattcatcccaga
acaaacagcaaaactttttatattgctgaacaggtgtcccatcatccaccaatatctgcc
ttttatgttagtaatcgaaaagatggattttgccttagcggtagtatcctggctaagtct
aagttttatggaaactcattatctgcaatattagagggagaagcacggttaactttcttg
aatagaggtgaagattatgtaatgacaatgccatacgctcattgtaaaggaattctttat
ggtacaatgacactggagcttggtggaacagtcaatattacatgtcaaaaaactggatac
agtgcaatacttgaatttaaactaaagccattcctagggagtagtgactgtgttaatcaa
atatcagggaaacttaaactgggaaaagaagtcctagctactttggaaggtcattgggat
agtgaagtttttattactgataaaaagactgataattcagaggttttctggaatccaaca
cctgacattaagcaatggagattaataaggcacactgtaaaatttgaagaacagggagat
tttgaatcagagaaactctggcaacgggtaactcgagccataaatgccaaagaccaaact
gaagctacccaagagaagtatgttttggaagaagctcaaagacaagctgccagggatcgg
aaaacaaaaaatgaagagtggtcttgcaaattatttgaacttgatccactcacaggagaa
tggcattacaagtttgcagatacccgaccatgggacccacttaatgatatgatacagttt
gaaaaagatggtgttattcagaccaaagtgaaacatcgtactccaatggttagcgtcccc
aaaatgaaacataagccaaccaggcaacagaagaaagtagcaaaaggctattcctcccca
gaacctgacattcaagactcctctggaagtgaagctcaatcagtaaaaccaagtacaaga
agaaagaaaggaatagaactgggagacattcagagttccatcgaatctataaaacaaaca
caggaagaaattaaaagaaatattatggctcttcgaaatcatttagtttcaagcacaccg
gccacggattattttctgcaacaaaaagactacttcatcattttcctcctgattttgctt
caagtcataataaacttcatgttcaagtag

DBGET integrated database retrieval system