KEGG   Homo sapiens (human): 114883
Entry
114883            CDS       T01001                                 
Symbol
OSBPL9, ORP-9, ORP9
Name
(RefSeq) oxysterol binding protein like 9
  KO
K20465  oxysterol-binding protein-related protein 9/10/11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114883 (OSBPL9)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    114883 (OSBPL9)
SSDB
Motif
Pfam: Oxysterol_BP PH PH_8 PH_11 PH_6 PH_20 FapA Snapin_Pallidin
Other DBs
NCBI-GeneID: 114883
NCBI-ProteinID: NP_078862
OMIM: 606737
HGNC: 16386
Ensembl: ENSG00000117859
Pharos: Q96SU4(Tbio)
UniProt: Q96SU4
Position
1:51617092..51789219
AA seq 736 aa
MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGI
DDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHTLQLQGLDSGFVPSVQDFD
KKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIA
KDQSNAEKHADGMISTINPVDAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLP
VGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE
FHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLNSSLSNGTSDADLFDSHDDRD
DDAEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSI
SDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVS
EGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIG
QGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGG
KKHRITAEIFSPNDKKSFCSIEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQ
NEYESRSLWKDVTFNLKIRDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGEC
WVYDEPLLKRLGAAKH
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgtccatcatggaagggccgctgagcaaatggactaacgtgatgaagggctggcag
taccgttggttcgtgctggactacaatgcaggactgctctcctactacacgtccaaggac
aaaatgatgagaggctctcgcagaggatgtgttagactcagaggagctgtgattggtata
gacgatgaggacgacagcaccttcacaataactgttgatcagaaaaccttccatttccag
gcccgtgatgctgatgagcgagagaagtggatccatgccttagaagaaacaattcttcga
catactctccagcttcaaggtttggattcaggatttgttcctagtgtccaagattttgat
aagaaacttacagaagctgatgcttacctacaaatcttgattgaacaattaaagcttttt
gatgacaagcttcaaaactgcaaagaagatgaacagagaaagaaaattgaaactctcaaa
gagacaacaaatagcatggtagaatcaattaaacactgcattgtgttgctgcagattgcc
aaagaccagagtaatgcggagaagcacgcagatggaatgataagtactattaatcccgta
gatgcaatatatcaacctagtcctttggaacctgtgatcagcacaatgccttcccagact
gtgttacctccagaacctgttcagttgtgtaagtcagagcagcgtccatcttccctacca
gttggacctgtgttggctaccttgggacatcatcagactcctacaccaaatagtacaggc
agtggccattcaccaccgagtagcagtctcacttctccaagccacgtgaacttgtctcca
aatacagtcccagagttctcttactccagcagtgaagatgaattttatgatgctgatgaa
ttccatcaaagtggctcatccccaaagcgcttaatagattcttctggatctgcctcagtc
ctgacacacagcagctcgggaaatagtctaaaacgcccagataccacagaatcacttaat
tcttccttgtccaatggaacaagtgatgctgacctgtttgattcacatgatgacagagat
gatgatgcggaggcagggtctgtggaggagcacaagagcgttatcatgcatctcttgtcg
caggttagacttggaatggatcttactaaggtagttcttccaacgtttattcttgaaaga
agatctcttttagaaatgtatgcagacttttttgcacatccggacctgtttgtgagcatt
agtgaccagaaggatcccaaggatcgaatggttcaggttgtgaaatggtacctctcagcc
tttcatgcgggaaggaaaggatcagttgccaaaaagccatacaatcccattttgggcgag
atttttcagtgtcattggacattaccaaatgatactgaagagaacacagaactagtttca
gaaggaccagttccctgggtttccaaaaacagtgtaacatttgtggctgagcaggtttcc
catcatccacccatttcagccttttatgctgagtgttttaacaagaagatacaattcaat
gctcatatctggaccaaatcaaaattccttgggatgtcaattggggtgcacaacataggg
cagggctgtgtctcatgtctagactatgatgaacattacattctcacattccccaatggc
tatggaaggtctatcctcacagtgccctgggtggaattaggaggagaatgcaatattaat
tgttccaaaacaggctatagtgcaaatatcatcttccacactaaacccttctatgggggc
aagaagcacagaattactgccgagattttttctccaaatgacaagaagtctttttgctca
attgaaggggaatggaatggtgtgatgtatgcaaaatatgcaacaggggaaaatacagtc
tttgtagataccaagaagttgcctataatcaagaagaaagtgaggaagttggaagatcag
aacgagtatgaatcccgcagcctttggaaggatgtcactttcaacttaaaaatcagagac
attgatgcagcaactgaagcaaagcacaggcttgaagaaagacaaagagcagaagcccga
gaaaggaaggagaaggaaattcagtgggagacaaggttatttcatgaagatggagaatgc
tgggtttatgatgaaccattactgaaacgtcttggtgctgccaagcattag

DBGET integrated database retrieval system