KEGG   Homo sapiens (human): 114884
Entry
114884            CDS       T01001                                 
Symbol
OSBPL10, ORP10, OSBP9
Name
(RefSeq) oxysterol binding protein like 10
  KO
K20465  oxysterol-binding protein-related protein 9/10/11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114884 (OSBPL10)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    114884 (OSBPL10)
SSDB
Motif
Pfam: Oxysterol_BP PH_8 PH PH_6 Flagellar_rod
Other DBs
NCBI-GeneID: 114884
NCBI-ProteinID: NP_060254
OMIM: 606738
HGNC: 16395
Ensembl: ENSG00000144645
Pharos: Q9BXB5(Tbio)
UniProt: Q9BXB5 Q9NX98
Position
3:complement(31660825..32077692)
AA seq 764 aa
MERAVQGTDGGGGSNSSSRSSSRATSAGSSPSCSLAGRGVSSRSAAAGLGGGGSRSSPGS
VAASPSGGGGRRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRG
VLSLSGAIVSLSDEAPHMLVVYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKS
APSSRSRSLTLLPHGTPNSASPCSQRHLSVGAPGVVTITHHKSPAAARRAKSQYSGQLHE
VREMMNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLNLLQQSV
HQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAILPNSAEDEQTS
QPEPEPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPT
FILEKRSLLEMYADFMAHPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYN
PIIGETFHCSWEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYKLRFVAEQVSHHPPIS
CFYCECEEKRLCVNTHVWTKSKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSIL
TIPWVELGGKVSINCAKTGYSATVIFHTKPFYGGKVHRVTAEVKHNPTNTIVCKAHGEWN
GTLEFTYNNGETKVIDTTTLPVYPKKIRPLEKQGPMESRNLWREVTRYLRLGDIDAATEQ
KRHLEEKQRVEERKRENLRTPWKPKYFIQEGDGWVYFNPLWKAH
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggagagggcagtccagggcacagacggcggcgggggtagcaacagcagcagccgcagc
agcagccgtgctacctcggcgggctcctcgccctcctgctctctggcgggccggggggtc
tccagccggtcggcggcggccgggctcggcggcgggggaagccgcagcagcccgggctct
gtggccgctagcccgtccgggggaggcggccgcaggagggagccggcgctcgagggcgtg
ctcagcaaatacaccaacctcctccagggctggcagaacaggtacttcgtactggatttc
gaggctggcatcctgcagtattttgtgaatgagcaaagcaaacaccagaagcctcgagga
gtcctgtctttatctggagccatagtgtccctgagcgatgaagctccccacatgctggtg
gtgtactctgctaatggagagatgtttaaactgagagctgctgatgcaaaagagaaacaa
ttctgggtgactcagcttcgagcttgtgccaaataccacatggaaatgaattctaagagt
gctccaagctcccgaagccgaagtctcactttgctcccacatggaacacccaattctgcg
tctccctgtagccagagacacctcagtgtgggggcccccggtgttgtcacaatcacgcat
cacaagtcgcctgcagccgcccgaagagccaagagtcagtattccggccagcttcacgaa
gtcagagagatgatgaaccaggtggaagggcagcagaagaaccttgtgcacgccattgag
tccctgccagggtccggccccctcactgccttggaccaggacctgctgctcctgaaagct
acctctgctgccaccctcagctgccttggggagtgcctcaacttgttacagcagagtgtg
caccaggcgggccagcccagccagaagccaggagcctcggaaaacatcctgggatggcac
gggtccaagtcacattccacagagcagctgaaaaatgggacacttggctctttgccatca
gccagtgccaacataacctgggcaattttaccaaactctgctgaagacgaacaaacctca
cagccagagccagagccaaactcaggctctgaattggttttgtctgaagatgaaaaaagt
gacaatgaagataaggaagagacggaattgggcgtcatggaggatcagcgtagtataatt
cttcatctcatttcacaactcaaacttggaatggatttgaccaaggtggtgcttcccacc
tttatcctggagaagcgatctttgctggagatgtatgcagatttcatggcgcacccagac
ctactgctggccatcaccgctggggccacaccagaggagagagtcatttgcttcgttgag
tattatctcacagcctttcacgagggccgcaagggcgctttagccaagaagccctacaac
cccatcataggcgagacatttcactgctcctgggaagttcccaaggacagggtcaagcct
aagaggactgcttcccgctctcctgccagctgtcacgaacacccaatggccgatgaccct
tccaaaagctacaaactaaggtttgtggctgagcaagtgtcccatcacccacccatctcc
tgcttctactgtgagtgcgaggagaagagactgtgcgtcaacactcatgtatggaccaaa
agcaagttcatgggcatgtccgtgggggtctctatgataggggaaggtgtgttgaggctc
ctggaacacggggaggagtacgtattcaccctgcctagtgcctacgcccggtccattctc
accatcccgtgggtggagctcggaggaaaagtcagcatcaactgtgccaagactgggtac
tcagcgacagtgatattccacacgaagcctttctatggagggaaagtccacagggttacc
gcagaagtgaagcacaacccaaccaacaccattgtttgtaaagcccatggggaatggaat
ggtactttagagttcacctacaacaatggagaaaccaaagtcatcgacacaaccacactg
ccagtgtatcccaagaagatcagacctcttgagaagcagggacccatggagtccaggaac
ctctggcgggaggtgacccgatacctgcggctgggggacattgacgcagccaccgagcag
aagcggcacctggaggagaagcaacgggtggaggaacggaagcgcgagaacctccgcaca
ccatggaagcccaaatattttatccaggagggcgatggctgggtatacttcaatcccctc
tggaaagcacactga

DBGET integrated database retrieval system