KEGG   Homo sapiens (human): 114885Help
Entry
114885            CDS       T01001                                 

Gene name
OSBPL11, ORP-11, ORP11, OSBP12, TCCCIA00292
Definition
(RefSeq) oxysterol binding protein like 11
  KO
K20465  oxysterol-binding protein-related protein 9/10/11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114885 (OSBPL11)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    114885 (OSBPL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxysterol_BP PH PH_8 PH_6 PH_9 PH_13
Motif
Other DBs
NCBI-GeneID: 114885
NCBI-ProteinID: NP_073613
OMIM: 606739
HGNC: 16397
Ensembl: ENSG00000144909
Vega: OTTHUMG00000159571
Pharos: Q9BXB4(Tbio)
UniProt: Q9BXB4 A0A140VJQ6
Structure
PDB: 

Position
3q21.2
AA seq 747 aa AA seqDB search
MQGGEPVSTMKVSESEGKLEGQATAVTPNKNSSCGGGISSSSSSRGGSAKGWQYSDHMEN
VYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAVISPSDEDS
HTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIGKNNPPLKSRSFSLASSSN
SPISQRRPSQNAISFFNVGHSKLQSLSKRTNLPPDHLVEVREMMSHAEGQQRDLIRRIEC
LPTSGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHASHQKGSLPSGTTIEWLEPKI
SLSNHYKNGADQPFATDQSKPVAVPEEQPVAESGLLAREPEEINADDEIEDTCDHKEDDL
GAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDLFIAITNGAT
AEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWKMPKSEVASSVFSSSSTQG
VTNHAPLSGESLTQVGSDCYTVRFVAEQVSHHPPVSGFYAECTERKMCVNAHVWTKSKFL
GMSIGVTMVGEGILSLLEHGEEYTFSLPCAYARSILTVPWVELGGKVSVNCAKTGYSASI
TFHTKPFYGGKLHRVTAEVKHNITNTVVCRVQGEWNSVLEFTYSNGETKYVDLTKLAVTK
KRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTLEERQRTEERHRTETGTPWKT
KYFIKEGDGWVYHKPLWKIIPTTQPAE
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggggtgaaccagtgtccacaatgaaagtctcggagagcgaaggaaagctggag
ggccaggccacagcggtgaccccgaacaagaacagcagctgtggaggtggaatcagtagc
agcagcagcagccgcggtggcagtgcaaaaggctggcagtacagtgatcacatggaaaat
gtgtatggctatttaatgaagtataccaaccttgtcactgggtggcagtacaggtttttt
gttttaaacaatgaagctgggctgttggagtactttgtgaatgaacagtctagaaatcag
aaacctagaggaactttgcagcttgcaggagctgtaatatcacccagtgatgaggattct
cacaccttcactgtaaacgctgccagtggggaacaatataaactcagagctacagatgca
aaagagcgacagcactgggttagcagacttcagatatgtacacagcatcatactgaagct
attggaaagaataatcctcctctgaagtcacggagcttctcacttgcatctagtagtaat
tctcctatatcgcagaggagaccaagtcaaaatgccatttctttttttaatgttggacat
tccaaactgcaatcactgagcaaaagaactaatttacctccagaccatcttgtggaagtc
agagaaatgatgtctcatgctgaaggacaacaaagagacttaattagacgaattgaatgc
cttcctacttctggccatcttagttccttggaccaggatctcttaatgctcaaagctact
tccatggcaactatgaactgcttaaatgactgctttcatattctccagttacagcatgca
tcacatcagaagggctcattgccttcaggaacgacaatcgagtggttagaaccaaagata
tctttatcaaaccactataaaaatggagctgaccagccctttgcaactgatcagagtaag
ccggtggcagtcccagaagagcagcctgttgcagaatctggactattagcgagggagcct
gaagaaataaatgcagatgatgagatagaggatacatgtgaccacaaagaggatgacctg
ggagctgtagaagaacaacgtagtgtcatcctacatctcttgtcacagcttaagctgggc
atggatttaacaagagtggtgcttcctacatttatcctagagaagcgttccttgctggaa
atgtatgcagactttatgtctcatccagacctatttatagccatcactaatggagccaca
gctgaggacagaatgattcgctttgttgagtactaccttacctcatttcatgaaggccgt
aagggagccattgctaaaaaaccatacaatcctatcattggagaaacatttcactgttcc
tggaagatgccaaaaagcgaggtagcatccagtgtttttagcagttcttccacccaggga
gtcacaaatcatgctcctttatcgggggagtctttgacccaggtgggatcagactgttac
acagtcagatttgttgctgagcaggtttctcatcatcctccagtctcaggattttatgca
gaatgtacagagaggaagatgtgtgtaaatgcgcatgtctggactaagagcaagttctta
ggcatgtcaataggcgtgacaatggttggagaaggtatccttagtctgttggagcatgga
gaagagtacacattttctctaccctgtgcatatgctcggtcaattttgactgttccttgg
gtagaactgggtggcaaagtcagtgtcaactgtgcaaaaactggatattcagccagcatc
acttttcataccaagccattttatggtggcaaactgcatcgggttacagctgaagtaaag
cacaacatcaccaacactgtggtatgcagagtgcaaggggaatggaatagtgttcttgag
ttcacatatagcaatggagagacaaagtatgtggacttgactaaattggcagtgacgaag
aaaagagtgagacctctggagaagcaggatccatttgaatccaggcgattgtggaaaaat
gtgacagactcgctgagagaatctgaaattgataaggccacagagcataagcataccctg
gaagaacgtcagaggactgaagaaaggcatcgtactgaaacaggcacaccttggaaaacc
aaatattttattaaagagggagatggctgggtttatcataaaccactttggaaaataatt
ccaacaacacaaccagcagagtga

DBGET integrated database retrieval system