KEGG   Homo sapiens (human): 1149
Entry
1149              CDS       T01001                                 
Symbol
CIDEA, CIDE-A
Name
(RefSeq) cell death inducing DFFA like effector a
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CIDE-N DUF3721 GCV_T
Other DBs
NCBI-GeneID: 1149
NCBI-ProteinID: NP_001270
OMIM: 604440
HGNC: 1976
Ensembl: ENSG00000176194
Pharos: O60543(Tbio)
UniProt: O60543 Q8N5P9
Structure
Position
18:12254361..12277595
AA seq 219 aa
MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELIS
KTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSP
PKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYS
AQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
NT seq 660 nt   +upstreamnt  +downstreamnt
atggaggccgcccgggactatgcaggagccctcatcaggcccctgacatttatgggatca
cagactaagcgagtcctgttcaccccgctcatgcatccagctcgccctttccgggtctcc
aaccatgacaggagcagccggcgtggggtgatggcaagcagcctgcaggagctcatcagc
aagactctggatgccctcgtcatcgctaccggactggtcactctggtgctggaggaagat
ggcaccgtggtggacacagaagagttctttcagaccttgggagacaacacgcatttcatg
atcttggaaaaaggacagaagtggatgccgggcagccagcacgtccccacttgctcgccg
ccgaagaggtcgggaatagcgagagtcaccttcgacttgtacaggctgaaccccaaggac
ttcatcggctgccttaacgtgaaggccaccatgtatgagatgtactccgtgtcctacgac
atccggtgcacgggactcaagggcctgctgaggagtctgctgcggttcctgtcctactcc
gcccaggtgacgggacagtttctcatctatctgggcacatacatgctccgggtgctggat
gacaaggaagagcggccatccctccggtcacaagccaagggcaggttcacgtgtggatag

DBGET integrated database retrieval system