KEGG   Homo sapiens (human): 114902
Entry
114902            CDS       T01001                                 
Symbol
C1QTNF5, CTRP5, MFRP
Name
(RefSeq) C1q and TNF related 5
  KO
K24212  complement C1q and tumor necrosis factor-related protein 5
Organism
hsa  Homo sapiens (human)
Disease
H01130  Late-onset retinal degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    114902 (C1QTNF5)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 C1q domain-containing proteins
  Adiponectin / short collagen group proteins
   114902 (C1QTNF5)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 114902
NCBI-ProteinID: NP_001265360
OMIM: 608752
HGNC: 14344
Ensembl: ENSG00000223953
Pharos: Q9BXJ0(Tbio)
UniProt: Q9BXJ0 A0A024R3F8
Structure
Position
11:complement(119338942..119346705)
AA seq 243 aa
MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPG
APGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSD
APLPFDRVLVNEQGHYDAVTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQ
FFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSP
VFA
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaggccactcctcgtcctgctgctcctgggcctggcggccggctcgcccccactggac
gacaacaagatccccagcctctgcccggggcaccccggccttccaggcacgccgggccac
catggcagccagggcttgccgggccgcgatggccgcgacggccgcgacggcgcgcccggg
gctccgggagagaaaggcgagggcgggaggccgggactgccgggacctcgaggggacccc
gggccgcgaggagaggcgggacccgcggggcccaccgggcctgccggggagtgctcggtg
cctccgcgatccgccttcagcgccaagcgctccgagagccgggtgcctccgccgtctgac
gcacccttgcccttcgaccgcgtgctggtgaacgagcagggacattacgacgccgtcacc
ggcaagttcacctgccaggtgcctggggtctactacttcgccgtccatgccaccgtctac
cgggccagcctgcagtttgatctggtgaagaatggcgaatccattgcctctttcttccag
tttttcggggggtggcccaagccagcctcgctctcggggggggccatggtgaggctggag
cctgaggaccaagtgtgggtgcaggtgggtgtgggtgactacattggcatctatgccagc
atcaagacagacagcaccttctccggatttctggtgtactccgactggcacagctcccca
gtctttgcttag

DBGET integrated database retrieval system